StarFunc result for job id A6NHR8

User Input

>input (397 residues)
MGDQRPRDRPRSPGMDCKPWYCDKPPSKYIAKRKHRRLRFPPMDTQNWVFVKESMDSFHY
GCPSPEDMLICRLNEFLLPKISHRGPQADPKSRQKKLLKKVALFSKLLPAQPAWKAFVEE
AQLMAKHPLAMYPNLGEDMPPDLLLQMLKLLDPERKLEKAWAYCEGREKTIKEPTKPEPP
KAPVSHHFLEPPKIRASCLKELLQEDTPSTTECVSDSLQHRYTSRKMHDFKWARDMGVDE
ESIRNLFDFTPKWRATYEDQQIKKIKEWVSELQYRIKLDEMDEVESSQEKDWDRKLQMAP
NSYTAQCVKMRYGVWYLKPKLGKKLRSDQPLIDPKLLLEKPDEPDILDDLYGPIAFKDFI
LSKGYEMPGIIERLCARKGWTYDSVKTPVQRAMRLYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NA70	0.176	0.120	1.120E-32	645	0.733	0.451	Q8NA70.pdb.gz	FA47B_HUMAN Protein FAM47B OS=Homo sapiens OX=9606 GN=FAM47B PE=1 SV=2
2	AFDB:Q5JRC9	0.144	0.085	5.039E-28	791	0.771	0.387	Q5JRC9.pdb.gz	FA47A_HUMAN Protein FAM47A OS=Homo sapiens OX=9606 GN=FAM47A PE=1 SV=3
3	AFDB:Q6ZV65	0.151	0.153	1.118E-15	393	0.355	0.359	Q6ZV65.pdb.gz	FA47E_HUMAN Protein FAM47E OS=Homo sapiens OX=9606 GN=FAM47E PE=1 SV=3
4	AFDB:Q7PIR5	0.078	0.047	8.912E-1	793	0.091	0.045	Q7PIR5.pdb.gz	TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae OX=7165 GN=Tret1 PE=1 SV=3
5	AFDB:Q75JH1	0.119	0.096	9.481E-1	522	0.076	0.057	Q75JH1.pdb.gz	Q75JH1_DICDI RRM Nup35-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276109 PE=4 SV=1
6	AFDB:Q8BWB1	0.086	0.046	1.215	975	0.131	0.053	Q8BWB1.pdb.gz	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
7	AFDB:H9XVM8	0.107	0.059	1.375	860	0.141	0.065	H9XVM8.pdb.gz	H9XVM8_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1674 PE=1 SV=1
8	AFDB:Q95Y80	0.092	0.057	1.375	853	0.179	0.083	Q95Y80.pdb.gz	BET1_CAEEL Bromodomain-containing protein bet-1 OS=Caenorhabditis elegans OX=6239 GN=bet-1 PE=1 SV=3
9	AFDB:P27792	0.114	0.150	1.463	278	0.111	0.158	P27792.pdb.gz	LYL1_MOUSE Protein lyl-1 OS=Mus musculus OX=10090 GN=Lyl1 PE=2 SV=2
10	AFDB:P25724	0.112	0.111	1.656	401	0.103	0.102	P25724.pdb.gz	NANOS_DROME Protein nanos OS=Drosophila melanogaster OX=7227 GN=nanos PE=1 SV=1
11	PDB:7ajuCL	0.085	0.049	3.779	808	0.025	0.012	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7dcoL	0.094	0.087	5.151	435	0.103	0.094	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
13	PDB:5nrlG	0.078	0.082	7.470	372	0.076	0.081	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
14	PDB:2g28B	0.068	0.037	8.995	801	0.013	0.006	2g28B.pdb.gz	A Thiamin-bound, Pre-decarboxylation Reaction Intermediate Analogue in the Pyruvate Dehydrogenase E1 Subunit Induces Large Scale Disorder-to-Order Transformations in the Enzyme and Reveals Novel Structural Features in the Covalently Bound Adduct.
15	PDB:7mqaSI	0.103	0.060	8.995	803	0.048	0.024	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JRC9	6.51e-110	342	791	0.433	0.217	FA47A_HUMAN Protein FAM47A OS=Homo sapiens OX=9606 GN=FAM47A PE=1 SV=3
2	Q8NA70	1.10e-100	314	645	0.436	0.268	FA47B_HUMAN Protein FAM47B OS=Homo sapiens OX=9606 GN=FAM47B PE=1 SV=2
3	Q6ZV65	1.01e-65	216	393	0.378	0.382	FA47E_HUMAN Protein FAM47E OS=Homo sapiens OX=9606 GN=FAM47E PE=1 SV=3
4	A9ZSZ2	1.3	33.9	926	0.065	0.028	AGO3_BOMMO Piwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=AGO3 PE=1 SV=2
5	W6RTA4	4.4	32.3	8922	0.045	0.002	CLA1_CAEEL Protein clarinet OS=Caenorhabditis elegans OX=6239 GN=cla-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14642 FAM47	1.2e-96	334.7	FAM47 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418648	0.564	Ubinuclein-2
2	9606.ENSP00000382871	0.554	Melanoma-associated antigen B16
3	9606.ENSP00000367882	0.545	LanC-like protein 3
4	9606.ENSP00000297866	0.536	Cilia- and flagella-associated protein 47
5	9606.ENSP00000367926	0.536	Cilia- and flagella-associated protein 47
6	9606.ENSP00000367929	0.536	Cilia- and flagella-associated protein 47
7	9606.ENSP00000055682	0.526	Neurite extension and migration factor
8	9606.ENSP00000280886	0.520	Disco interacting protein 2 homolog C
9	9606.ENSP00000262043	0.507	PHD finger protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.761	molecular function regulator activity
GO:0140677	0.617	molecular function activator activity
GO:0030234	0.349	enzyme regulator activity
GO:0008047	0.302	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031056	0.845	regulation of histone modification
GO:0009987	0.824	cellular process
GO:0009893	0.819	positive regulation of metabolic process
GO:0050794	0.783	regulation of cellular process
GO:0031401	0.777	positive regulation of protein modification process
GO:0031060	0.765	regulation of histone methylation
GO:0006325	0.751	chromatin organization
GO:0033365	0.746	protein localization to organelle
GO:0034502	0.727	protein localization to chromosome
GO:0031058	0.726	positive regulation of histone modification
GO:0048522	0.656	positive regulation of cellular process
GO:0031325	0.646	positive regulation of cellular metabolic process
GO:0031062	0.631	positive regulation of histone methylation
GO:0071168	0.501	protein localization to chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005634	0.995	nucleus
GO:0005737	0.993	cytoplasm
GO:0005694	0.993	chromosome
GO:0000785	0.961	chromatin
GO:0120025	0.369	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]