StarFunc result for job id A6NHR9

User Input

>input (2005 residues)
MAAADGGGPGGASVGTEEDGGGVGHRTVYLFDRREKESELGDRPLQVGERSDYAGFRACV
CQTLGISPEEKFVITTTSRKEITCDNFDETVKDGVTLYLLQSVNQLLLTATKERIDFLPH
YDTLVKSGMYEYYASEGQNPLPFALAELIDNSLSATSRNIGVRRIQIKLLFDETQGKPAV
AVIDNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGK
QAVFFVGQSARMISKPADSQDVHELVLSKEDFEKKEKNKEAIYSGYIRNRKPSDSVHITN
DDERFLHHLIIEEKEKDSFTAVVITGVQPEHIQYLKNYFHLWTRQLAHIYHYYIHGPKGN
EIRTSKEVEPFNNIDIEISMFEKGKVPKIVNLREIQDDMQTLYVNTAADSFEFKAHVEGD
GVVEGIIRYHPFLYDRETYPDDPCFPSKLKDEDDEDDCFILEKAARGKRPIFECFWNGRL
IPYTSVEDFDWCTPPKKRGLAPIECYNRISGALFTNDKFQVSTNKLTFMDLELKLKDKNT
LFTRILNGQEQRMKIDREFALWLKDCHEKYDKQIKFTLFKGVITRPDLPSKKQGPWATYA
AIEWDGKIYKAGQLVKTIKTLPLFYGSIVRFFLYGDHDGEVYATGGEVQIAMEPQALYDE
VRTVPIAKLDRTVAEKAVKKYVEDEMARLPDRLSVTWPEGDELLPNEVRPAGTPIGALRI
EILNKKGEAMQKLPGTSHGGSKKLLVELKVILHSSSGNKEIISHISQHGGKWPYWFKKME
NIQKLGNYTLKLQVVLNESNADTYAGRPLPSKAIKFSVKEGKPEKFSFGLLDLPFRVGVP
FNIPLEFQDEFGHTSQLVTDIQPVLEASGLSLHYEEITKGPNCVIRGVTAKGPVNSCQGK
NYNLKVTLPGLKEDSQILKIRLLPGHPRRLKVKPDSEILVIENGTAFPFQVEVLDESDNI
TAQPKLIVHCKFSGAPNLPVYVVDCSSSGTSILTGSAIQVQNIKKDQTLKARIEIPSCKD
VAPVEKTIKLLPSSHVARLQIFSVEGQKAIQIKHQDEVNWIAGDIMHNLIFQMYDEGERE
INITSALAEKIKVNWTPEINKEHLLQGLLPDVQVPTSVKDMRYCQVSFQDDHVSLESAFT
VRPLPDEPKHLKCEMKGGKTVQMGQELQGEVVIIITDQYGNQIQAFSPSSLSSLSIAGVG
LDSSNLKTTFQENTQSISVRGIKFIPGPPGNKDLCFTWREFSDFIRVQLISGPPAKLLLI
DWPELKESIPVINGRDLQNPIIVQLCDQWDNPAPVQHVKISLTKASNLKLMPSNQQHKTD
EKGRANLGVFSVFAPRGEHTLQVKAIYNKSIIEGPIIKLMILPDPEKPVRLNVKYDKDAS
FLAGGLFTDFMISVISEDDSIIKNINPARISMKMWKLSTSGNRPPANAETFSCNKIKDND
KEDGCFYFRDKVIPNKVGTYCIQFGFMMDKTNILNSEQVIVEVLPNQPVKLVPKIKPPTP
AVSNVRSVASRTLVRDLHLSITDDYDNHTGIDLVGTIIATIKGSNEEDTDTPLFIGKVRT
LEFPFVNGSAEIMSLVLAESSPGRDSTEYFIVFEPRLPLLSRTLEPYILPFMFYNDVKKQ
QQMAALTKEKDQLSQSIVMYKSLFEASQQLLNEMKCQVEEARLKEAQLRNELKIHNIDIP
TTQQVPHIEALLKRKLSEQEELKKKPRRSCTLPNYTKGSGDVLGKIAHLAQIEDDRAAMV
ISWHLASDMDCVVTLTTDAARRIYDETQGRQQVLPLDSIYKKTLPDWKRSLPHFRNGKLY
FKPIGDPVFARDLLTFPDNVEHCETVFGMLLGDTIILDNLDAANHYRKEVVKITHCPTLL
TRDGDRIRSNGKFGGLQNKAPPMDKLRGMVFGAPVPKQCLILGEQIDLLQQYRSAVCKLD
SVNKDLNSQLEYLRTPDMRKKKQELDEHEKNLKLIEEKLGMTPIRKCNDSLRHSPKVETT
DCPVPPKRMRREATRQNRIITKTDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2L6F5	0.547	0.551	0.000	1983	0.488	0.493	A0A0G2L6F5.pdb.gz
2	AFDB:A6NHR9	1.000	1.000	0.000	2005	1.000	1.000	A6NHR9.pdb.gz	SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2
3	AFDB:Q6P5D8	0.492	0.491	0.000	2007	0.865	0.864	Q6P5D8.pdb.gz	SMHD1_MOUSE Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Mus musculus OX=10090 GN=Smchd1 PE=1 SV=2
4	AFDB:F4KFS5	0.245	0.298	1.401E-53	1598	0.125	0.157	F4KFS5.pdb.gz	GMI1_ARATH Structural maintenance of chromosomes flexible hinge domain-containing protein GMI1 OS=Arabidopsis thaliana OX=3702 GN=GMI1 PE=2 SV=1
5	AFDB:A1Z6H7	0.084	0.087	4.449E-21	1876	0.061	0.066	A1Z6H7.pdb.gz	PO210_DROME Nuclear pore membrane glycoprotein 210 OS=Drosophila melanogaster OX=7227 GN=Gp210 PE=1 SV=1
6	AFDB:P91495	0.062	0.066	6.566E-21	1847	0.070	0.076	P91495.pdb.gz	P91495_CAEEL BIG2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-12 PE=1 SV=1
7	AFDB:P22063	0.073	0.105	3.381E-19	1040	0.053	0.102	P22063.pdb.gz	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
8	PDB:7sqcO0	0.076	0.120	4.786E-19	1140	0.052	0.091	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	AFDB:A0A2R8QA12	0.076	0.113	1.386E-18	1040	0.053	0.102	A0A2R8QA12.pdb.gz
10	AFDB:Q9VN14	0.116	0.144	1.604E-18	1390	0.062	0.090	Q9VN14.pdb.gz	CONT_DROME Contactin OS=Drosophila melanogaster OX=7227 GN=Cont PE=1 SV=2
11	PDB:5a42A	0.079	0.092	1.780E-18	1597	0.067	0.084	5a42A.pdb.gz
12	AFDB:Q9VAF5	0.121	0.134	2.255E-18	1706	0.060	0.070	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
13	PDB:7q1yA	0.066	0.088	3.198E-15	1374	0.048	0.071	7q1yA.pdb.gz
14	PDB:6h03A	0.072	0.104	4.079E-15	1223	0.059	0.096	6h03A.pdb.gz
15	PDB:7q5zA	0.062	0.085	7.679E-15	1344	0.049	0.073	7q5zA.pdb.gz
16	PDB:4ziqA	0.069	0.090	8.464E-15	1450	0.055	0.076	4ziqA.pdb.gz
17	PDB:5oj2B	0.067	0.127	1.249E-14	692	0.048	0.139	5oj2B.pdb.gz
18	PDB:7nycA	0.070	0.084	1.249E-14	1542	0.057	0.074	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:4aq1A	0.070	0.144	3.149E-14	721	0.047	0.132	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
20	PDB:1e07A	0.077	0.175	3.644E-14	642	0.048	0.151	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NHR9	0.0	4147	2005	1.000	1.000	SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2
2	Q6P5D8	0.0	3645	2007	0.865	0.864	SMHD1_MOUSE Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Mus musculus OX=10090 GN=Smchd1 PE=1 SV=2
3	Q8TZY2	8.12e-04	47.0	1177	0.042	0.071	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2
4	Q09591	0.003	45.1	1244	0.023	0.038	MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans OX=6239 GN=mix-1 PE=1 SV=2
5	A0A0H2UQ93	0.006	44.3	1179	0.043	0.073	A0A0H2UQ93_STRPN Chromosome partition protein Smc OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=smc PE=1 SV=1
6	Q584X8	0.67	37.4	470	0.015	0.064	Q584X8_TRYB2 AAA+ ATPase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.620 PE=4 SV=1
7	F4ISL7	1.2	36.6	2166	0.024	0.023	TI236_ARATH Protein TIC236, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC236 PE=1 SV=1
8	P0DJD9	3.0	35.0	388	0.010	0.052	PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens OX=9606 GN=PGA5 PE=1 SV=1
9	D7F7X0	3.4	35.0	623	0.017	0.055	D7F7X0_ONCMY RNA helicase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=dhx58 PE=2 SV=1
10	P0DJD8	4.3	34.7	388	0.010	0.052	PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens OX=9606 GN=PGA3 PE=1 SV=1
11	A0A8I5Y6F6	5.6	34.3	558	0.015	0.054	A0A8I5Y6F6_RAT Protein kinase AMP-activated non-catalytic subunit gamma 2 OS=Rattus norvegicus OX=10116 GN=Prkag2 PE=4 SV=1
12	F4KFS5	5.9	34.3	1598	0.017	0.021	GMI1_ARATH Structural maintenance of chromosomes flexible hinge domain-containing protein GMI1 OS=Arabidopsis thaliana OX=3702 GN=GMI1 PE=2 SV=1
13	O75674	7.5	33.9	476	0.015	0.063	TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2
14	Q9NSD9	9.1	33.5	589	0.012	0.042	SYFB_HUMAN Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07889 DUF1664	9.7e+02	11.2	Protein of unknown function (DUF1664)
2	PF02518 HATPase_c	1.1e+02	14.7	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	1.3e-09	49.6	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
4	PF06470 SMC_hinge	2.4e-09	48.9	SMC proteins Flexible Hinge Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326603

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451207	0.862	Double homeobox 4 like 1
2	9606.ENSP00000451411	0.862	Double homeobox 4 like 7
3	9606.ENSP00000458065	0.862	Double homeobox protein 4
4	9606.ENSP00000485452	0.862	Double homeodomain protein DUX4-s
5	9606.ENSP00000358778	0.761	Ligand-dependent nuclear receptor-interacting factor 1
6	9606.ENSP00000324810	0.738	Multivesicular body subunit 12A
7	9606.ENSP00000328059	0.723	E3 ubiquitin-protein ligase RLIM
8	9606.ENSP00000264010	0.695	Transcriptional repressor CTCF
9	9606.ENSP00000303427	0.691	Sister chromatid cohesion protein PDS5 homolog A
10	9606.ENSP00000336687	0.685	Chromobox protein homolog 3
11	9606.ENSP00000251968	0.681	Tumor susceptibility gene 101 protein
12	9606.ENSP00000323889	0.680	E3 ubiquitin/ISG15 ligase TRIM25
13	9606.ENSP00000347495	0.680	Tryptophan--tRNA ligase, cytoplasmic
14	9606.ENSP00000355465	0.667	Protein ELYS
15	9606.ENSP00000358374	0.661	Protein SCAF11
16	9606.ENSP00000458290	0.660	N(6)-adenine-specific DNA methyltransferase that mediates methylation of DNA on the 6th position of adenine (N(6)- methyladenosine) and is required to regulate Polycomb silencing. N(6)- methyladenosine deposition by METTL4 triggers ubiquitination and degradation of sensor proteins ASXL1 and MPND, leading to inactivation of the PR-DUB complex and subsequent preservation of Polycomb silencing
17	9606.ENSP00000275034	0.657	PH-interacting protein
18	9606.ENSP00000439479	0.641	DmX-like protein 1
19	9606.ENSP00000329558	0.628	GrpE protein homolog 2, mitochondrial
20	9606.ENSP00000452398	0.626	Double homeobox protein A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.960	catalytic activity
GO:0016787	0.555	hydrolase activity
GO:0042802	0.502	identical protein binding
GO:0140657	0.401	ATP-dependent activity
GO:0017111	0.365	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.362	ATP hydrolysis activity
GO:1901363	0.317	heterocyclic compound binding
GO:0097159	0.317	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.996	regulation of biological process
GO:0007549	0.985	dosage compensation
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0048519	0.978	negative regulation of biological process
GO:0010605	0.974	negative regulation of macromolecule metabolic process
GO:0019219	0.973	regulation of nucleobase-containing compound metabolic process
GO:0006338	0.927	chromatin remodeling
GO:0051052	0.884	regulation of DNA metabolic process
GO:0048518	0.868	positive regulation of biological process
GO:0045934	0.867	negative regulation of nucleobase-containing compound metabolic process
GO:0048522	0.856	positive regulation of cellular process
GO:0009893	0.849	positive regulation of metabolic process
GO:0010604	0.810	positive regulation of macromolecule metabolic process
GO:0048583	0.793	regulation of response to stimulus
GO:0051173	0.772	positive regulation of nitrogen compound metabolic process
GO:0031325	0.772	positive regulation of cellular metabolic process
GO:2001020	0.661	regulation of response to DNA damage stimulus
GO:0006282	0.601	regulation of DNA repair
GO:0045935	0.560	positive regulation of nucleobase-containing compound metabolic process
GO:2000779	0.539	regulation of double-strand break repair
GO:0032502	0.462	developmental process
GO:0000018	0.424	regulation of DNA recombination
GO:0045814	0.424	negative regulation of gene expression, epigenetic
GO:0070828	0.358	heterochromatin organization
GO:0051054	0.342	positive regulation of DNA metabolic process
GO:0048856	0.340	anatomical structure development
GO:0045739	0.321	positive regulation of DNA repair
GO:0051053	0.312	negative regulation of DNA metabolic process
GO:0032501	0.310	multicellular organismal process
GO:0010569	0.304	regulation of double-strand break repair via homologous recombination
GO:2000781	0.304	positive regulation of double-strand break repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000805	0.999	X chromosome
GO:0000228	0.999	nuclear chromosome
GO:0005654	0.968	nucleoplasm
GO:0098687	0.872	chromosomal region
GO:0001740	0.760	Barr body
GO:0000781	0.601	chromosome, telomeric region
GO:0005737	0.539	cytoplasm
GO:0032991	0.362	protein-containing complex
GO:0090734	0.360	site of DNA damage
GO:0000785	0.307	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.555	Hydrolases.
RHEA:23680	0.365	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.365	nucleoside-triphosphate phosphatase.
RHEA:13065	0.362	ATP + H2O = ADP + H(+) + phosphate

[back to server]