StarFunc result for job id A6NI15

User Input

>input (193 residues)
MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLESYSSSP
CPAVAGLPCEHGGASSGGSEGCSVGGASGLVEVDYNMLAFQPTHLQGGGGPKAQKGTKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTD
LLNRGREPRAQSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NI15	1.000	1.000	2.389E-29	193	1.000	1.000	A6NI15.pdb.gz	MSGN1_HUMAN Mesogenin-1 OS=Homo sapiens OX=9606 GN=MSGN1 PE=1 SV=1
2	AFDB:Q9JK54	0.589	0.600	1.351E-20	188	0.772	0.793	Q9JK54.pdb.gz	MSGN1_MOUSE Mesogenin-1 OS=Mus musculus OX=10090 GN=Msgn1 PE=2 SV=1
3	AFDB:A3KPB3	0.347	0.265	2.067E-5	256	0.306	0.230	A3KPB3.pdb.gz
4	AFDB:B3DFN8	0.353	0.308	2.532E-5	223	0.321	0.278	B3DFN8.pdb.gz
5	AFDB:P97309	0.264	0.211	2.709E-5	243	0.301	0.239	P97309.pdb.gz	MESP1_MOUSE Mesoderm posterior protein 1 OS=Mus musculus OX=10090 GN=Mesp1 PE=2 SV=2
6	AFDB:I2AVW0	0.272	0.216	6.983E-5	244	0.301	0.238	I2AVW0.pdb.gz	I2AVW0_DANRE Mesoderm posterior bb OS=Danio rerio OX=7955 GN=mesp-bb PE=2 SV=1
7	AFDB:Q0VG99	0.276	0.156	3.787E-4	397	0.316	0.154	Q0VG99.pdb.gz	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
8	AFDB:Q9BRJ9	0.269	0.195	6.960E-4	268	0.275	0.198	Q9BRJ9.pdb.gz	MESP1_HUMAN Mesoderm posterior protein 1 OS=Homo sapiens OX=9606 GN=MESP1 PE=1 SV=1
9	AFDB:B3DKC1	0.309	0.254	7.447E-4	236	0.223	0.182	B3DKC1.pdb.gz
10	AFDB:F1R9F5	0.214	0.159	1.794E-3	261	0.269	0.199	F1R9F5.pdb.gz	F1R9F5_DANRE Basic helix-loop-helix family, member e22 OS=Danio rerio OX=7955 GN=Beta3.1 PE=4 SV=1
11	PDB:7u7nD	0.120	0.121	4.085	191	0.104	0.105	7u7nD.pdb.gz
12	PDB:6mzcK	0.135	0.129	4.371	202	0.052	0.050	6mzcK.pdb.gz
13	PDB:3ojaA	0.215	0.099	5.004	482	0.067	0.027	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
14	PDB:7wtwt	0.148	0.232	5.004	108	0.098	0.176	7wtwt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:7z1mO	0.162	0.064	5.354	570	0.036	0.012	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
16	PDB:5v8f4	0.128	0.036	7.017	741	0.041	0.011	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
17	PDB:7ktrH	0.139	0.225	7.508	99	0.073	0.141	7ktrH.pdb.gz	Structure of the human SAGA coactivator complex.
18	PDB:1lujB	0.097	0.182	9.196	71	0.057	0.155	1lujB.pdb.gz
19	PDB:6wjv4	0.153	0.248	9.840	107	0.083	0.150	6wjv4.pdb.gz
20	PDB:7wtxt	0.154	0.200	9.840	132	0.067	0.098	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NI15	2.06e-141	393	193	1.000	1.000	MSGN1_HUMAN Mesogenin-1 OS=Homo sapiens OX=9606 GN=MSGN1 PE=1 SV=1
2	Q9JK54	6.46e-100	288	188	0.772	0.793	MSGN1_MOUSE Mesogenin-1 OS=Mus musculus OX=10090 GN=Msgn1 PE=2 SV=1
3	Q90ZL1	1.91e-29	107	131	0.368	0.542	MSGN1_DANRE Mesogenin-1 OS=Danio rerio OX=7955 GN=msgn1 PE=2 SV=1
4	Q9BRJ9	1.96e-16	77.0	268	0.197	0.142	MESP1_HUMAN Mesoderm posterior protein 1 OS=Homo sapiens OX=9606 GN=MESP1 PE=1 SV=1
5	P97309	2.38e-16	76.3	243	0.207	0.165	MESP1_MOUSE Mesoderm posterior protein 1 OS=Mus musculus OX=10090 GN=Mesp1 PE=2 SV=2
6	Q0VG99	6.52e-16	77.0	397	0.192	0.093	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
7	I2AVV9	4.92e-15	72.8	240	0.181	0.146	I2AVV9_DANRE Mesoderm posterior ab OS=Danio rerio OX=7955 GN=mesp2 PE=2 SV=1
8	O08574	6.03e-15	73.9	370	0.187	0.097	MESP2_MOUSE Mesoderm posterior protein 2 OS=Mus musculus OX=10090 GN=Mesp2 PE=1 SV=1
9	I2AVW0	7.82e-15	72.4	244	0.259	0.205	I2AVW0_DANRE Mesoderm posterior bb OS=Danio rerio OX=7955 GN=mesp-bb PE=2 SV=1
10	Q9IB70	4.01e-13	67.4	223	0.171	0.148	Q9IB70_DANRE BHLH transcription factor Mesp-a OS=Danio rerio OX=7955 GN=mesp-a PE=2 SV=1
11	Q9IB69	1.38e-12	66.2	236	0.176	0.144	Q9IB69_DANRE BHLH transcription factor Mesp-b OS=Danio rerio OX=7955 GN=mesp-b PE=2 SV=1
12	O42202	5.31e-08	53.9	350	0.171	0.094	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
13	Q6NYU3	6.32e-08	53.5	327	0.171	0.101	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
14	P48986	4.53e-07	51.2	337	0.171	0.098	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
15	Q91616	4.64e-07	51.2	352	0.150	0.082	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
16	Q9HD90	8.13e-07	50.4	331	0.150	0.088	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
17	Q15784	1.17e-06	50.1	382	0.166	0.084	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2
18	Q62414	1.17e-06	50.1	383	0.166	0.084	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
19	P41894	1.21e-06	50.1	384	0.166	0.083	DEI_DROME Helix-loop-helix protein delilah OS=Drosophila melanogaster OX=7227 GN=tx PE=1 SV=3
20	F1QWM8	1.22e-06	50.1	348	0.150	0.083	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	3.1e-07	41.6	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281047

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378650	0.824	T-box transcription factor TBX6
2	9606.ENSP00000404092	0.721	Structural maintenance of chromosomes protein 6
3	9606.ENSP00000420180	0.667	Coiled-coil domain-containing protein 14
4	9606.ENSP00000446205	0.661	Transcription factor HES-7
5	9606.ENSP00000352248	0.634	Annexin A10
6	9606.ENSP00000296946	0.624	Brachyury protein
7	9606.ENSP00000384719	0.616	Visinin-like protein 1
8	9606.ENSP00000321684	0.576	Homeobox protein MOX-1
9	9606.ENSP00000349677	0.573	Testican-3
10	9606.ENSP00000314480	0.563	Homeobox protein unc-4 homolog
11	9606.ENSP00000365280	0.554	DNA-binding protein inhibitor ID-1
12	9606.ENSP00000362613	0.545	Homeobox protein CDX-4
13	9606.ENSP00000262013	0.543	C-Jun-amino-terminal kinase-interacting protein 4
14	9606.ENSP00000277541	0.515	Neurogenic locus notch homolog protein 1
15	9606.ENSP00000246080	0.514	Transcription factor 15
16	9606.ENSP00000334051	0.509	Guanine nucleotide-binding protein G(olf) subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.975	transcription regulator activity
GO:0003700	0.974	DNA-binding transcription factor activity
GO:0000976	0.879	transcription cis-regulatory region binding
GO:0000981	0.865	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.436	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.994	anatomical structure development
GO:0009653	0.972	anatomical structure morphogenesis
GO:0065007	0.949	biological regulation
GO:0050789	0.943	regulation of biological process
GO:0032501	0.901	multicellular organismal process
GO:0009888	0.900	tissue development
GO:0050794	0.891	regulation of cellular process
GO:0009987	0.849	cellular process
GO:0007275	0.836	multicellular organism development
GO:0060429	0.818	epithelium development
GO:0035282	0.678	segmentation
GO:0061053	0.629	somite development
GO:0043009	0.599	chordate embryonic development
GO:0019222	0.589	regulation of metabolic process
GO:0060255	0.582	regulation of macromolecule metabolic process
GO:0010468	0.574	regulation of gene expression
GO:0080090	0.554	regulation of primary metabolic process
GO:0051171	0.554	regulation of nitrogen compound metabolic process
GO:0048518	0.508	positive regulation of biological process
GO:0048646	0.490	anatomical structure formation involved in morphogenesis
GO:0001756	0.472	somitogenesis
GO:0048513	0.469	animal organ development
GO:0007379	0.464	segment specification
GO:0019219	0.454	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.451	regulation of biosynthetic process
GO:0031326	0.437	regulation of cellular biosynthetic process
GO:0048522	0.430	positive regulation of cellular process
GO:0048731	0.426	system development
GO:1903506	0.417	regulation of nucleic acid-templated transcription
GO:0006355	0.398	regulation of DNA-templated transcription
GO:0009893	0.313	positive regulation of metabolic process
GO:0006357	0.304	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.918	intracellular organelle lumen
GO:0031981	0.913	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]