StarFunc result for job id A6NI72

User Input

>input (391 residues)
MGDTFIRHIALLGFEKRFVPSQHYVRYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFP
IEAGAINPENRIIPHLPAPKWFDGQRAAENHQGTLTEYCGTLMSLPTKISRCPHLLDFFK
VRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALST
GDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTA
VEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAP
PRRSSIRNVHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRS
KPQPAVPPRPSADLILNRCSESTKRKLASAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14598	0.865	0.867	2.538E-70	390	0.980	0.982	P14598.pdb.gz	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
2	AFDB:Q09014	0.821	0.823	1.265E-62	390	0.803	0.805	Q09014.pdb.gz	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
3	AFDB:B5X4S7	0.639	0.611	1.921E-48	413	0.532	0.504	B5X4S7.pdb.gz	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
4	AFDB:A2BFP2	0.519	0.498	3.327E-47	410	0.535	0.510	A2BFP2.pdb.gz
5	AFDB:A1X283	0.322	0.141	1.963E-28	911	0.294	0.126	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
6	AFDB:Q5TCZ1	0.327	0.116	9.299E-27	1133	0.286	0.099	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
7	AFDB:A2AAY5	0.322	0.142	3.182E-26	908	0.276	0.119	A2AAY5.pdb.gz	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
8	AFDB:Q1LYG0	0.319	0.115	7.361E-26	1119	0.266	0.093	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
9	AFDB:Q8NFA2	0.329	0.342	2.861E-21	376	0.225	0.234	Q8NFA2.pdb.gz	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
10	AFDB:Q8VCM2	0.353	0.393	7.826E-21	349	0.220	0.246	Q8VCM2.pdb.gz	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
11	PDB:2dybA	0.227	0.293	1.643E-10	298	0.133	0.174	2dybA.pdb.gz
12	PDB:1griA	0.136	0.245	1.383E-4	211	0.079	0.147	1griA.pdb.gz
13	PDB:2lqnA	0.134	0.171	1.729E-4	303	0.082	0.106	2lqnA.pdb.gz
14	PDB:2eyzA	0.160	0.197	2.705E-4	304	0.095	0.122	2eyzA.pdb.gz
15	PDB:3ehqA	0.141	0.293	1.294E-3	182	0.043	0.093	3ehqA.pdb.gz
16	PDB:2h8hA	0.138	0.121	1.619E-3	445	0.036	0.031	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:1k9aB	0.142	0.126	2.264E-3	441	0.051	0.045	1k9aB.pdb.gz
18	PDB:4mt6A	0.127	0.127	2.394E-3	389	0.043	0.044	4mt6A.pdb.gz
19	PDB:1ocuA	0.241	0.625	2.677E-3	134	0.059	0.172	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
20	PDB:3qwyA	0.138	0.310	4.683E-3	170	0.051	0.118	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M707	0.0	671	389	0.816	0.820	NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus OX=10116 GN=Ncf1 PE=1 SV=2
2	P14598	0.0	800	390	0.990	0.992	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
3	Q09014	0.0	670	390	0.813	0.815	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
4	Q4Z8P3	5.90e-152	437	410	0.540	0.515	Q4Z8P3_DANRE Neutrophil cytosol factor 1 OS=Danio rerio OX=7955 GN=cb893 PE=2 SV=1
5	B8YQ98	8.31e-151	434	413	0.540	0.511	B8YQ98_SALSA NADPH oxidase cytosolic protein OS=Salmo salar OX=8030 GN=p47phox PE=2 SV=1
6	B5X4S7	1.84e-150	433	413	0.542	0.513	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
7	A1X283	1.90e-55	197	911	0.271	0.116	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
8	A2AAY5	9.32e-54	193	908	0.263	0.113	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
9	O89032	2.79e-53	192	1124	0.271	0.094	SPD2A_MOUSE SH3 and PX domain-containing protein 2A OS=Mus musculus OX=10090 GN=Sh3pxd2a PE=1 SV=2
10	Q5TCZ1	3.15e-53	192	1133	0.271	0.094	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
11	Q1LYG0	2.68e-50	184	1119	0.253	0.088	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
12	Q8NFA2	6.94e-24	103	376	0.187	0.194	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
13	Q8VCM2	3.46e-20	92.8	349	0.187	0.209	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
14	Q9NZM3	2.11e-13	74.3	1697	0.125	0.029	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
15	Q9Z0R6	5.46e-12	70.1	1659	0.128	0.030	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
16	H0YKF1	1.67e-09	57.8	133	0.059	0.173	H0YKF1_HUMAN Proline-serine-threonine phosphatase interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=1 SV=1
17	Q9Z0R4	1.86e-09	62.0	1714	0.110	0.025	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
18	O61639	2.40e-09	61.6	1011	0.110	0.043	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
19	Q8INU2	2.75e-09	61.6	1014	0.110	0.042	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
20	M9PDC7	2.89e-09	61.2	1005	0.110	0.043	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14603 hSH3	39	16.2	Helically-extended SH3 domain
2	PF16621 NECFESHC	1.5e-17	74.5	SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
3	PF08944 p47_phox_C	1.5e-16	70.8	NADPH oxidase subunit p47Phox, C terminal domain
4	PF00787 PX	3.1e-13	61.5	PX domain
5	PF00018 SH3_1	1.2e-24	97.0	SH3 domain
6	PF07653 SH3_2	8.2e-14	62.5	Variant SH3 domain
7	PF08239 SH3_3	15	17.4	Bacterial SH3 domain
8	PF12913 SH3_6	1.7e+02	13.2	SH3 domain (SH3b1 type)
9	PF14604 SH3_9	4e-18	76.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289473

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261623	0.999	Cytochrome b-245 light chain
2	9606.ENSP00000356505	0.999	Neutrophil cytosol factor 2
3	9606.ENSP00000367851	0.999	Cytochrome b-245 heavy chain
4	9606.ENSP00000380334	0.998	Neutrophil cytosol factor 4
5	9606.ENSP00000362057	0.997	NADPH oxidase 1
6	9606.ENSP00000249071	0.995	Ras-related C3 botulinum toxin substrate 2
7	9606.ENSP00000305355	0.992	Protein kinase C beta type
8	9606.ENSP00000367830	0.991	Protein kinase C zeta type
9	9606.ENSP00000342848	0.990	NADPH oxidase activator 1
10	9606.ENSP00000378217	0.988	Protein kinase C delta type
11	9606.ENSP00000451828	0.987	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000262395	0.982	TNF receptor-associated factor 4
13	9606.ENSP00000408695	0.981	Protein kinase C alpha type
14	9606.ENSP00000348461	0.969	Ras-related C3 botulinum toxin substrate 1
15	9606.ENSP00000263317	0.966	NADPH oxidase 4
16	9606.ENSP00000159060	0.964	NADPH oxidase 3
17	9606.ENSP00000278568	0.963	Serine/threonine-protein kinase PAK 1
18	9606.ENSP00000229795	0.956	Mitogen-activated protein kinase 14
19	9606.ENSP00000263025	0.954	Mitogen-activated protein kinase 3
20	9606.ENSP00000353408	0.954	Moesin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.974	lipid binding
GO:0005543	0.942	phospholipid binding
GO:0003824	0.913	catalytic activity
GO:0035091	0.903	phosphatidylinositol binding
GO:0043167	0.895	ion binding
GO:0043168	0.869	anion binding
GO:0043325	0.844	phosphatidylinositol-3,4-bisphosphate binding
GO:0098772	0.722	molecular function regulator activity
GO:0030234	0.643	enzyme regulator activity
GO:0140677	0.633	molecular function activator activity
GO:0008047	0.598	enzyme activator activity
GO:0016176	0.420	superoxide-generating NADPH oxidase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.995	response to stimulus
GO:0050789	0.990	regulation of biological process
GO:0044237	0.986	cellular metabolic process
GO:0072593	0.973	reactive oxygen species metabolic process
GO:0048583	0.965	regulation of response to stimulus
GO:0050794	0.957	regulation of cellular process
GO:0048518	0.948	positive regulation of biological process
GO:0009607	0.937	response to biotic stimulus
GO:0009605	0.933	response to external stimulus
GO:0044419	0.925	biological process involved in interspecies interaction between organisms
GO:0051716	0.916	cellular response to stimulus
GO:0006952	0.905	defense response
GO:0042221	0.886	response to chemical
GO:0070887	0.878	cellular response to chemical stimulus
GO:0048522	0.869	positive regulation of cellular process
GO:0019222	0.841	regulation of metabolic process
GO:1901700	0.807	response to oxygen-containing compound
GO:1901701	0.778	cellular response to oxygen-containing compound
GO:0031323	0.770	regulation of cellular metabolic process
GO:0048584	0.766	positive regulation of response to stimulus
GO:0080134	0.729	regulation of response to stress
GO:0060255	0.723	regulation of macromolecule metabolic process
GO:0006801	0.721	superoxide metabolic process
GO:0043207	0.665	response to external biotic stimulus
GO:0080090	0.628	regulation of primary metabolic process
GO:0023051	0.620	regulation of signaling
GO:0010646	0.620	regulation of cell communication
GO:0009966	0.612	regulation of signal transduction
GO:0010033	0.608	response to organic substance
GO:0002376	0.592	immune system process
GO:0051707	0.579	response to other organism
GO:0071704	0.571	organic substance metabolic process
GO:0006968	0.554	cellular defense response
GO:0009893	0.547	positive regulation of metabolic process
GO:0051171	0.543	regulation of nitrogen compound metabolic process
GO:0031325	0.496	positive regulation of cellular metabolic process
GO:0023052	0.474	signaling
GO:0007154	0.474	cell communication
GO:1902531	0.471	regulation of intracellular signal transduction
GO:0065009	0.468	regulation of molecular function
GO:0051179	0.466	localization
GO:0007165	0.462	signal transduction
GO:0010604	0.461	positive regulation of macromolecule metabolic process
GO:0010468	0.446	regulation of gene expression
GO:0009967	0.429	positive regulation of signal transduction
GO:0051173	0.420	positive regulation of nitrogen compound metabolic process
GO:0051239	0.419	regulation of multicellular organismal process
GO:0044238	0.405	primary metabolic process
GO:0032501	0.368	multicellular organismal process
GO:0019220	0.365	regulation of phosphate metabolic process
GO:0051246	0.361	regulation of protein metabolic process
GO:0044093	0.354	positive regulation of molecular function
GO:0051247	0.354	positive regulation of protein metabolic process
GO:0043085	0.340	positive regulation of catalytic activity
GO:0042325	0.332	regulation of phosphorylation
GO:0071310	0.325	cellular response to organic substance
GO:0048519	0.322	negative regulation of biological process
GO:0002682	0.320	regulation of immune system process
GO:0098542	0.307	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0071944	0.984	cell periphery
GO:0043226	0.983	organelle
GO:0005886	0.962	plasma membrane
GO:0043229	0.952	intracellular organelle
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0032991	0.924	protein-containing complex
GO:0031982	0.858	vesicle
GO:0031410	0.751	cytoplasmic vesicle
GO:0098797	0.672	plasma membrane protein complex
GO:1902494	0.654	catalytic complex
GO:0012505	0.479	endomembrane system
GO:1990204	0.414	oxidoreductase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]