StarFunc result for job id A6NI73

User Input

>input (299 residues)
MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRG
NSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYS
PAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHK
LSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAA
DNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NI73	1.000	1.000	7.681E-58	299	1.000	1.000	A6NI73.pdb.gz	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
2	AFDB:Q8NHJ6	0.656	0.446	1.255E-33	448	0.532	0.355	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
3	AFDB:Q64281	0.664	0.595	1.399E-33	335	0.435	0.388	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
4	AFDB:O75022	0.655	0.314	1.938E-33	631	0.528	0.250	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
5	AFDB:Q61450	0.663	0.654	4.624E-33	303	0.408	0.403	Q61450.pdb.gz	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
6	AFDB:P59901	0.521	0.319	2.006E-32	499	0.595	0.357	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
7	AFDB:Q8N149	0.608	0.381	7.341E-29	483	0.572	0.354	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
8	AFDB:O76036	0.634	0.624	1.111E-27	304	0.365	0.359	O76036.pdb.gz	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
9	AFDB:Q28109	0.586	0.657	1.812E-27	264	0.385	0.436	Q28109.pdb.gz	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
10	AFDB:O75023	0.621	0.322	4.323E-27	590	0.458	0.232	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
11	PDB:5c6wJ	0.276	0.331	6.533E-8	238	0.120	0.151	5c6wJ.pdb.gz
12	PDB:1ngwH	0.254	0.321	9.888E-7	216	0.114	0.157	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
13	PDB:1aifA	0.246	0.324	1.297E-6	215	0.110	0.153	1aifA.pdb.gz
14	PDB:1cf8L	0.276	0.359	1.703E-6	215	0.120	0.167	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
15	PDB:2ig2H	0.277	0.332	2.004E-6	238	0.114	0.143	2ig2H.pdb.gz
16	PDB:1l9mB	0.242	0.136	2.491E-6	681	0.117	0.051	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
17	PDB:6vpyL	0.271	0.334	3.268E-6	209	0.124	0.177	6vpyL.pdb.gz
18	PDB:1f11A	0.255	0.334	4.062E-6	216	0.110	0.153	1f11A.pdb.gz
19	PDB:6kzbC	0.241	0.136	4.062E-6	649	0.090	0.042	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
20	PDB:4lluB	0.247	0.330	4.288E-6	210	0.084	0.119	4lluB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NI73	0.0	615	299	1.000	1.000	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
2	O75022	1.15e-102	315	631	0.528	0.250	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	Q8NHJ6	5.54e-90	276	448	0.498	0.333	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
4	O75023	1.61e-85	269	590	0.482	0.244	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
5	P59901	4.11e-85	266	499	0.472	0.283	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
6	O75019	3.15e-81	255	489	0.452	0.276	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
7	Q8N6C8	5.03e-77	243	439	0.441	0.301	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
8	Q8N149	6.08e-77	244	483	0.438	0.271	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
9	Q8NHL6	9.75e-76	245	650	0.445	0.205	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
10	Q8N423	3.85e-72	234	597	0.418	0.209	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
11	Q64281	2.00e-70	223	335	0.408	0.364	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
12	Q61450	1.74e-68	217	303	0.381	0.376	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
13	P97484	2.92e-60	207	841	0.381	0.136	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
14	Q8C567	3.90e-60	196	325	0.388	0.357	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
15	Q8K4V6	1.81e-58	200	697	0.391	0.168	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
16	Q28109	9.07e-57	185	264	0.398	0.451	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
17	O76036	7.23e-53	177	304	0.385	0.378	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
18	Q9HCN6	1.49e-47	164	339	0.368	0.324	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
19	P0C191	2.62e-42	149	313	0.355	0.339	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
20	Q99706	8.46e-42	150	377	0.344	0.273	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	0.00066	31.1	Immunoglobulin domain
2	PF13895 Ig_2	7.1e-12	56.8	Immunoglobulin domain
3	PF13927 Ig_3	0.00011	34.0	Immunoglobulin domain
4	PF16681 Ig_5	1.9e+02	13.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404236

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433642	0.855	Low affinity immunoglobulin gamma Fc region receptor III-B
2	9606.ENSP00000271450	0.847	Low affinity immunoglobulin gamma Fc region receptor II-a
3	9606.ENSP00000356946	0.845	Low affinity immunoglobulin gamma Fc region receptor III-A
4	9606.ENSP00000351497	0.842	Low affinity immunoglobulin gamma Fc region receptor II-b
5	9606.ENSP00000358165	0.838	High affinity immunoglobulin gamma Fc receptor I
6	9606.ENSP00000412927	0.707	HLA class I histocompatibility antigen, alpha chain G
7	9606.ENSP00000259951	0.682	HLA class I histocompatibility antigen, alpha chain F
8	9606.ENSP00000365817	0.677	HLA class I histocompatibility antigen, alpha chain E
9	9606.ENSP00000391592	0.664	Tyrosine-protein phosphatase non-receptor type 6
10	9606.ENSP00000399168	0.660	HLA class I histocompatibility antigen, B-7 alpha chain
11	9606.ENSP00000452780	0.652	Beta-2-microglobulin
12	9606.ENSP00000364907	0.647	Tyrosine-protein kinase SYK
13	9606.ENSP00000379873	0.645	HLA class I histocompatibility antigen, A-3 alpha chain
14	9606.ENSP00000365402	0.642	HLA class I histocompatibility antigen, Cw-7 alpha chain
15	9606.ENSP00000355995	0.577	Corticosteroid 11-beta-dehydrogenase isozyme 1
16	9606.ENSP00000329507	0.519	CMRF35-like molecule 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.995	signaling receptor activity
GO:0004888	0.651	transmembrane signaling receptor activity
GO:0044877	0.376	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0009987	0.981	cellular process
GO:0048583	0.980	regulation of response to stimulus
GO:0048522	0.962	positive regulation of cellular process
GO:0080134	0.957	regulation of response to stress
GO:0050776	0.946	regulation of immune response
GO:0023052	0.941	signaling
GO:0048519	0.938	negative regulation of biological process
GO:0007166	0.929	cell surface receptor signaling pathway
GO:0001817	0.925	regulation of cytokine production
GO:0031347	0.910	regulation of defense response
GO:0001819	0.903	positive regulation of cytokine production
GO:0032101	0.883	regulation of response to external stimulus
GO:0051241	0.867	negative regulation of multicellular organismal process
GO:0006950	0.862	response to stress
GO:0002376	0.846	immune system process
GO:0032680	0.836	regulation of tumor necrosis factor production
GO:0002831	0.835	regulation of response to biotic stimulus
GO:0050865	0.796	regulation of cell activation
GO:0048523	0.756	negative regulation of cellular process
GO:0048584	0.715	positive regulation of response to stimulus
GO:0006952	0.706	defense response
GO:0031323	0.702	regulation of cellular metabolic process
GO:0045088	0.652	regulation of innate immune response
GO:0002684	0.622	positive regulation of immune system process
GO:0032102	0.567	negative regulation of response to external stimulus
GO:1903557	0.535	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0002683	0.532	negative regulation of immune system process
GO:0050867	0.532	positive regulation of cell activation
GO:0006955	0.523	immune response
GO:0002694	0.505	regulation of leukocyte activation
GO:0032501	0.491	multicellular organismal process
GO:0002764	0.476	immune response-regulating signaling pathway
GO:0002697	0.474	regulation of immune effector process
GO:0002768	0.463	immune response-regulating cell surface receptor signaling pathway
GO:0080090	0.459	regulation of primary metabolic process
GO:0065009	0.451	regulation of molecular function
GO:0031349	0.448	positive regulation of defense response
GO:0031348	0.430	negative regulation of defense response
GO:0032652	0.415	regulation of interleukin-1 production
GO:0002703	0.413	regulation of leukocyte mediated immunity
GO:0051246	0.402	regulation of protein metabolic process
GO:0050778	0.401	positive regulation of immune response
GO:0002706	0.399	regulation of lymphocyte mediated immunity
GO:0032651	0.396	regulation of interleukin-1 beta production
GO:0001775	0.384	cell activation
GO:0051249	0.384	regulation of lymphocyte activation
GO:0051174	0.382	regulation of phosphorus metabolic process
GO:0032103	0.363	positive regulation of response to external stimulus
GO:0002698	0.363	negative regulation of immune effector process
GO:0032760	0.359	positive regulation of tumor necrosis factor production
GO:0010605	0.358	negative regulation of macromolecule metabolic process
GO:0050777	0.354	negative regulation of immune response
GO:0044093	0.351	positive regulation of molecular function
GO:0030155	0.343	regulation of cell adhesion
GO:0023051	0.340	regulation of signaling
GO:0010646	0.340	regulation of cell communication
GO:0032732	0.336	positive regulation of interleukin-1 production
GO:0009607	0.328	response to biotic stimulus
GO:0031325	0.320	positive regulation of cellular metabolic process
GO:0032655	0.318	regulation of interleukin-12 production
GO:0031341	0.313	regulation of cell killing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005886	0.971	plasma membrane
GO:0005576	0.966	extracellular region
GO:0009986	0.956	cell surface
GO:0012505	0.933	endomembrane system
GO:0031982	0.918	vesicle
GO:0005615	0.890	extracellular space
GO:0031410	0.879	cytoplasmic vesicle
GO:0098588	0.796	bounding membrane of organelle
GO:0030659	0.793	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]