StarFunc result for job id A6NIR3

User Input

>input (686 residues)
MGNILTCCVHPSVSLEFDQQQGSVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHIRDQEMPEALEFSLSANPEASTIFQRNSQTDALEFNPSANPEASTIFQRNSQTD
VVEIRRSNCTNHVSTERFSQQYSSCSTIFLDDSTASQHYLTMTIISVTLEIPHHITQRDA
DRSLSIPDEQLHSFAVSTVHITKNRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTP
TPVCKRSMRWSNLFTSEKGSHPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTW
KKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKS
NGLSKDMDTGLGDSICFSPSISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQT
WHFEATTYEERDAWVQAIQSQILASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCV
DYETQNPKWASLNLGVLMCIECSGIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLA
NSIWEGSSQGQTKPSVKSTREEKERWIRSKYEEKLFLAPLPCTELSLGQHLLRATADEDL
QTAILLLAHGSREEVNETCGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTA
LTYARQASSQECINVLLQYGCPDECV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WZ64	0.227	0.098	2.439E-16	1704	0.185	0.075	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
2	AFDB:Q9QWY8	0.310	0.189	4.826E-14	1147	0.150	0.090	Q9QWY8.pdb.gz	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
3	PDB:3lvqE	0.246	0.381	2.073E-13	420	0.109	0.179	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
4	PDB:3ljuX	0.171	0.308	4.457E-9	373	0.066	0.121	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
5	PDB:3o47A	0.129	0.293	1.422E-5	289	0.052	0.125	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
6	AFDB:A2ABF8	0.131	0.080	1.699E-5	1233	0.175	0.097	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
7	AFDB:A8TT22	0.143	0.089	8.253E-5	1173	0.173	0.101	A8TT22.pdb.gz	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
8	PDB:8cs9A	0.131	0.113	1.192E-4	796	0.042	0.036	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
9	PDB:6bbpA	0.124	0.162	2.292E-4	520	0.044	0.058	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
10	PDB:6v9hC	0.127	0.316	3.545E-4	270	0.038	0.096	6v9hC.pdb.gz
11	PDB:4oauC	0.136	0.134	5.791E-4	692	0.042	0.042	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	AFDB:Q13009	0.162	0.080	7.305E-4	1591	0.152	0.065	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
13	AFDB:A2ABF9	0.151	0.093	8.146E-4	1267	0.172	0.093	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
14	PDB:6jd6B	0.126	0.436	1.055E-3	192	0.036	0.130	6jd6B.pdb.gz
15	PDB:4bszB	0.130	0.545	1.114E-3	150	0.039	0.180	4bszB.pdb.gz
16	AFDB:P34288	0.130	0.059	1.130E-3	1605	0.102	0.044	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
17	PDB:6hhgA	0.121	0.210	1.385E-3	386	0.038	0.067	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	AFDB:Q2IBD4	0.141	0.061	8.967E-3	1649	0.152	0.063	Q2IBD4.pdb.gz	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
19	AFDB:Q6W2J9	0.121	0.048	1.000E-2	1755	0.133	0.052	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
20	AFDB:Q5H9F3	0.120	0.049	1.313E-2	1711	0.150	0.060	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VHH5	0.0	551	910	0.434	0.327	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
2	Q9UPQ3	0.0	562	857	0.421	0.337	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
3	U6A022	0.0	568	808	0.417	0.354	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
4	J3KNM6	1.16e-146	455	1036	0.356	0.236	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
5	F8VVT9	5.19e-142	446	1192	0.359	0.206	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
6	Q99490	5.25e-142	446	1192	0.359	0.206	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
7	Q8CGU4	3.06e-136	431	1186	0.362	0.209	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
8	Q3UHD9	3.77e-136	431	1186	0.362	0.209	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
9	A0JMI1	3.84e-131	409	827	0.359	0.297	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
10	Q9XX14	4.13e-80	278	1107	0.270	0.167	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
11	Q9NGC3	4.74e-72	254	995	0.200	0.138	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
12	Q54WI0	1.72e-37	152	1333	0.168	0.086	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q8N7R7	1.60e-35	140	359	0.133	0.253	CCYL1_HUMAN Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1 PE=1 SV=2
14	Q4QQN0	1.58e-33	138	626	0.117	0.128	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	Q6NXL5	2.71e-33	139	833	0.117	0.096	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	A2ADA6	2.76e-33	139	829	0.117	0.097	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
17	Q3UH98	2.85e-33	139	833	0.117	0.096	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
18	Q15057	5.96e-30	128	778	0.109	0.096	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
19	Q5FVC7	1.21e-29	127	770	0.109	0.097	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
20	Q8MSZ5	1.35e-29	119	235	0.095	0.277	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.7e-06	38.3	Ankyrin repeat
2	PF12796 Ank_2	2e-06	39.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.2	20.8	Ankyrin repeat
4	PF13637 Ank_4	0.0045	28.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.7e-05	36.3	Ankyrin repeats (many copies)
6	PF01412 ArfGap	3.3e-31	119.2	Putative GTPase activating protein for Arf
7	PF00169 PH	4.7e-07	41.6	PH domain
8	PF15413 PH_11	0.12	24.2	Pleckstrin homology domain
9	PF15404 PH_4	74	14.6	Pleckstrin homology domain
10	PF15406 PH_6	3.7	19.3	Pleckstrin homology domain
11	PF15409 PH_8	6.5	18.4	Pleckstrin homology domain
12	PF15410 PH_9	6.9e+02	11.8	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342790	0.605	Family with sequence similarity 25 member A
2	9606.ENSP00000485370	0.556	Protein FAM25A
3	9606.ENSP00000361097	0.518	Multimerin-2
4	9606.ENSP00000310182	0.502	Uncharacterized protein FAM241A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0008289	0.987	lipid binding
GO:0005543	0.982	phospholipid binding
GO:0098772	0.874	molecular function regulator activity
GO:0030234	0.646	enzyme regulator activity
GO:0005096	0.606	GTPase activator activity
GO:1901981	0.430	phosphatidylinositol phosphate binding
GO:0043167	0.416	ion binding
GO:0043168	0.344	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.958	cellular process
GO:0065007	0.795	biological regulation
GO:0050789	0.569	regulation of biological process
GO:0032502	0.463	developmental process
GO:0050794	0.405	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.967	membrane
GO:0071944	0.934	cell periphery
GO:0005634	0.759	nucleus
GO:0012505	0.455	endomembrane system
GO:0005886	0.437	plasma membrane
GO:0005829	0.388	cytosol
GO:0070013	0.357	intracellular organelle lumen
GO:0031981	0.324	nuclear lumen
GO:0005794	0.314	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]