StarFunc result for job id A6NIX2

User Input

>input (430 residues)
MQRSRAGADEAALLLAGLALRELEPGCGSPGRGRRGPRPGPGDEAAPALGRRGKGSGGPE
AGADGLSRGERGPRRAAVPELSAQPAGSPRASLAGSDGGGGGGSARSSGISLGYDQRHGS
PRSGRSDPRPGPGPPSVGSARSSVSSLGSRGSAGAYADFLPPGACPAPARSPEPAGPAPF
PLPALPLPPGREGGPSAAERRLEALTRELERALEARTARDYFGICIKCGLGIYGAQQACQ
AMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEM
ILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPA
QGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRRCYPLAGHLLCRRCHLRRLQPGPL
PSPTVHVTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NIX2	1.000	1.000	6.488E-71	430	1.000	1.000	A6NIX2.pdb.gz	WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens OX=9606 GN=WTIP PE=1 SV=3
2	AFDB:Q9QXD8	0.419	0.282	2.104E-37	668	0.484	0.311	Q9QXD8.pdb.gz	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
3	AFDB:Q9N675	0.328	0.248	1.134E-25	585	0.284	0.209	Q9N675.pdb.gz	Q9N675_DROME Zyx102 protein OS=Drosophila melanogaster OX=7227 GN=Zyx PE=1 SV=1
4	AFDB:Q8T0F5	0.322	0.252	2.319E-25	564	0.295	0.225	Q8T0F5.pdb.gz	Q8T0F5_DROME LD06023 isoform OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
5	AFDB:A0A096MKD4	0.275	0.183	1.461E-14	679	0.209	0.133	A0A096MKD4.pdb.gz	A0A096MKD4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=2
6	AFDB:A0A1D8PRQ6	0.225	0.080	2.739E-10	1468	0.188	0.055	A0A1D8PRQ6.pdb.gz	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1
7	AFDB:A0A2R8Q2U1	0.245	0.125	6.458E-9	900	0.123	0.059	A0A2R8Q2U1.pdb.gz
8	AFDB:F2Z4V3	0.243	0.127	1.321E-8	872	0.100	0.049	F2Z4V3.pdb.gz	F2Z4V3_DANRE Prickle homolog 1b OS=Danio rerio OX=7955 GN=fb98c11 PE=3 SV=1
9	PDB:4kfzB	0.156	0.393	7.845E-8	148	0.070	0.203	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
10	PDB:1b8tA	0.139	0.298	4.525E-6	192	0.093	0.208	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
11	AFDB:O14014	0.147	0.070	1.670E-3	969	0.081	0.036	O14014.pdb.gz	RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga3 PE=1 SV=1
12	PDB:1imlA	0.135	0.619	4.568E-3	76	0.051	0.289	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
13	AFDB:F1RAC1	0.081	0.047	1.462E-1	1146	0.191	0.072	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
14	PDB:7c4cA	0.080	0.094	3.550E-1	332	0.049	0.063	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
15	PDB:7uhyD	0.098	0.138	3.999E-1	288	0.028	0.042	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:5dkaA	0.064	0.233	6.071E-1	96	0.028	0.125	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:5a31B	0.066	0.223	7.260E-1	84	0.021	0.107	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
18	PDB:7zsb4	0.063	0.084	8.683E-1	306	0.014	0.020	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
19	PDB:6ydhA	0.063	0.312	1.170	62	0.023	0.161	6ydhA.pdb.gz
20	PDB:4r8pL	0.075	0.119	1.318	254	0.026	0.043	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NIX2	0.0	846	430	1.000	1.000	WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens OX=9606 GN=WTIP PE=1 SV=3
2	Q7TQJ8	0.0	587	398	0.823	0.889	WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus OX=10090 GN=Wtip PE=1 SV=1
3	A9LS46	1.67e-138	414	690	0.581	0.362	WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis OX=8355 GN=wtip PE=1 SV=1
4	A8DZE6	4.31e-131	394	648	0.460	0.306	WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio OX=7955 GN=wtip PE=3 SV=1
5	Q9QXD8	2.51e-125	379	668	0.451	0.290	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
6	Q9UGP4	8.38e-122	370	676	0.388	0.247	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
7	Q06BR1	2.13e-115	352	612	0.356	0.250	LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=limd1 PE=1 SV=1
8	Q9VY77	2.07e-109	340	728	0.365	0.216	AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster OX=7227 GN=jub PE=1 SV=3
9	Q91XC0	4.74e-101	313	547	0.323	0.254	AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus OX=10090 GN=Ajuba PE=1 SV=1
10	Q96IF1	5.62e-101	313	538	0.321	0.257	AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1
11	Q5U2Z2	5.79e-101	313	548	0.323	0.254	AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus OX=10116 GN=Ajuba PE=1 SV=1
12	E7FFI0	1.61e-98	311	688	0.307	0.192	E7FFI0_DANRE Ajuba LIM protein OS=Danio rerio OX=7955 GN=ajuba PE=4 SV=1
13	C9JRJ5	4.41e-88	281	620	0.298	0.206	C9JRJ5_HUMAN LIM domain containing 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
14	Q7ZU85	1.43e-72	239	556	0.237	0.183	Q7ZU85_DANRE LIM domain containing preferred translocation partner in lipoma OS=Danio rerio OX=7955 GN=zgc:56152 PE=1 SV=1
15	Q93052	3.17e-70	234	612	0.237	0.167	LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1
16	A0A087WZF1	4.02e-70	234	590	0.237	0.173	A0A087WZF1_HUMAN LIM domain containing preferred translocation partner in lipoma OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1
17	Q8BFW7	9.05e-70	233	613	0.242	0.170	LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus OX=10090 GN=Lpp PE=1 SV=1
18	H9XVP5	1.23e-63	214	496	0.235	0.204	H9XVP5_DROME Zyxin, isoform H OS=Drosophila melanogaster OX=7227 GN=Zyx PE=4 SV=1
19	Q8T0F5	1.37e-63	216	564	0.235	0.179	Q8T0F5_DROME LD06023 isoform OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
20	Q8I0G8	1.84e-63	214	523	0.235	0.193	Q8I0G8_DROME FI16750p1 OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	2.5e-29	112.6	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466953

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437550	0.990	Serine/threonine-protein kinase LATS1
2	9606.ENSP00000372035	0.960	Serine/threonine-protein kinase LATS2
3	9606.ENSP00000324729	0.944	Protein salvador homolog 1
4	9606.ENSP00000349722	0.900	Ubiquitin conjugating enzyme E2 D3
5	9606.ENSP00000363019	0.900	Ubiquitin-conjugating enzyme E2 D1
6	9606.ENSP00000381717	0.900	Ubiquitin-conjugating enzyme E2 D2
7	9606.ENSP00000331327	0.856	Wilms tumor protein
8	9606.ENSP00000355133	0.843	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
9	9606.ENSP00000262713	0.817	LIM domain-containing protein ajuba
10	9606.ENSP00000273317	0.810	LIM domain-containing protein 1
11	9606.ENSP00000336127	0.712	Tetratricopeptide repeat protein 7B
12	9606.ENSP00000250457	0.702	Egl nine homolog 3
13	9606.ENSP00000256474	0.695	Von Hippel-Lindau disease tumor suppressor
14	9606.ENSP00000306822	0.682	Cell death regulator Aven
15	9606.ENSP00000273853	0.667	Centromere protein C
16	9606.ENSP00000478927	0.631	Transcriptional coactivator YAP1
17	9606.ENSP00000272317	0.612	Ubiquitin-40S ribosomal protein S27a
18	9606.ENSP00000366898	0.612	Hypoxia-inducible factor 3-alpha
19	9606.ENSP00000469876	0.610	Secretoglobin family 2B member 2
20	9606.ENSP00000444856	0.609	Cullin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.984	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.839	response to stimulus
GO:0019222	0.835	regulation of metabolic process
GO:0009966	0.829	regulation of signal transduction
GO:0060255	0.808	regulation of macromolecule metabolic process
GO:0010605	0.793	negative regulation of macromolecule metabolic process
GO:1902531	0.791	regulation of intracellular signal transduction
GO:0048523	0.737	negative regulation of cellular process
GO:0010468	0.715	regulation of gene expression
GO:0009968	0.704	negative regulation of signal transduction
GO:0048518	0.703	positive regulation of biological process
GO:0035331	0.653	negative regulation of hippo signaling
GO:0035194	0.635	RNA-mediated post-transcriptional gene silencing
GO:0035195	0.624	miRNA-mediated gene silencing
GO:0009628	0.612	response to abiotic stimulus
GO:0071840	0.606	cellular component organization or biogenesis
GO:1900368	0.606	regulation of post-transcriptional gene silencing by RNA
GO:0016043	0.579	cellular component organization
GO:0060964	0.485	regulation of miRNA-mediated gene silencing
GO:0008152	0.390	metabolic process
GO:0048522	0.380	positive regulation of cellular process
GO:0051171	0.369	regulation of nitrogen compound metabolic process
GO:0080090	0.368	regulation of primary metabolic process
GO:0031323	0.359	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0005829	0.951	cytosol
GO:0005634	0.946	nucleus
GO:0005654	0.924	nucleoplasm
GO:0099080	0.886	supramolecular complex
GO:0036464	0.833	cytoplasmic ribonucleoprotein granule
GO:0000932	0.808	P-body
GO:0070161	0.541	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]