StarFunc result for job id A6NJ46

User Input

>input (265 residues)
MESNLQGTFLLNNTPLAQFPEMKAPVCQYSVQNSFYKLSPPGLGPQLAAGTPHGITDILS
RPVAAPNNSLLSGYPHVAGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTGQDWR
GGRQCSNTPDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTE
SQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSD
DEKIRLLLRKHRAAFSVLSLGAHSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NJ46	1.000	1.000	1.125E-42	265	1.000	1.000	A6NJ46.pdb.gz	NKX63_HUMAN Homeobox protein Nkx-6.3 OS=Homo sapiens OX=9606 GN=NKX6-3 PE=2 SV=1
2	AFDB:B3DHA2	0.223	0.193	2.041E-9	309	0.226	0.194	B3DHA2.pdb.gz	B3DHA2_DANRE Homeo box HB9 like a OS=Danio rerio OX=7955 GN=hlxb9la PE=2 SV=1
3	AFDB:Q503F2	0.239	0.254	4.177E-9	248	0.208	0.222	Q503F2.pdb.gz	BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio OX=7955 GN=barx1 PE=2 SV=2
4	AFDB:P50576	0.217	0.204	7.505E-9	283	0.264	0.247	P50576.pdb.gz	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1
5	AFDB:Q3C1V8	0.243	0.273	9.739E-9	233	0.208	0.236	Q3C1V8.pdb.gz	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
6	AFDB:Q9UMQ3	0.235	0.224	9.739E-9	279	0.230	0.219	Q9UMQ3.pdb.gz	BARX2_HUMAN Homeobox protein BarH-like 2 OS=Homo sapiens OX=9606 GN=BARX2 PE=1 SV=3
7	AFDB:Q9ER42	0.228	0.237	1.039E-8	254	0.245	0.256	Q9ER42.pdb.gz	BARX1_MOUSE Homeobox protein BarH-like 1 OS=Mus musculus OX=10090 GN=Barx1 PE=2 SV=1
8	AFDB:B8JMG3	0.221	0.166	1.184E-8	356	0.208	0.154	B8JMG3.pdb.gz
9	AFDB:B3DJ06	0.233	0.191	1.349E-8	328	0.230	0.186	B3DJ06.pdb.gz
10	AFDB:G5EE18	0.222	0.290	1.640E-8	201	0.215	0.284	G5EE18.pdb.gz	CEH28_CAEEL Homeobox protein ceh-28 OS=Caenorhabditis elegans OX=6239 GN=ceh-28 PE=2 SV=1
11	PDB:2hi3A	0.196	0.628	3.379E-3	73	0.068	0.247	2hi3A.pdb.gz
12	PDB:4egcA	0.191	0.094	3.379E-3	539	0.060	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:5z56L	0.165	0.130	8.766E-2	342	0.057	0.044	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	PDB:7fbyA	0.143	0.229	1.794E-1	153	0.030	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:2cg4A	0.138	0.224	3.441E-1	149	0.030	0.054	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:5aj0BZ	0.154	0.409	6.183E-1	86	0.038	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:5mrca	0.109	0.156	6.599E-1	177	0.087	0.130	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:2vbwA	0.122	0.194	9.754E-1	147	0.034	0.061	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
19	PDB:2ffhA	0.185	0.122	1.041	407	0.038	0.025	2ffhA.pdb.gz
20	PDB:7awtE	0.120	0.196	1.111	156	0.034	0.058	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJ46	0.0	551	265	1.000	1.000	NKX63_HUMAN Homeobox protein Nkx-6.3 OS=Homo sapiens OX=9606 GN=NKX6-3 PE=2 SV=1
2	Q3UHX8	0.0	509	262	0.940	0.950	NKX63_MOUSE Homeobox protein Nkx-6.3 OS=Mus musculus OX=10090 GN=Nkx6-3 PE=2 SV=1
3	A0A0R4IY89	2.59e-73	227	278	0.506	0.482	A0A0R4IY89_DANRE Homeobox protein Nkx-6.2 OS=Danio rerio OX=7955 GN=nkx6.2 PE=4 SV=1
4	D3Z4R4	5.86e-68	213	277	0.506	0.484	D3Z4R4_MOUSE NK6 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=4 SV=1
5	Q9C056	1.67e-66	209	277	0.513	0.491	NKX62_HUMAN Homeobox protein Nkx-6.2 OS=Homo sapiens OX=9606 GN=NKX6-2 PE=1 SV=2
6	Q6DGK5	2.11e-62	200	312	0.517	0.439	Q6DGK5_DANRE Homeobox protein Nkx-6.1 OS=Danio rerio OX=7955 GN=zgc:92879 PE=2 SV=1
7	P78426	6.02e-56	185	367	0.457	0.330	NKX61_HUMAN Homeobox protein Nkx-6.1 OS=Homo sapiens OX=9606 GN=NKX6-1 PE=1 SV=2
8	Q99MA9	2.09e-55	184	365	0.525	0.381	NKX61_MOUSE Homeobox protein Nkx-6.1 OS=Mus musculus OX=10090 GN=Nkx6-1 PE=1 SV=1
9	O35762	3.25e-55	183	365	0.460	0.334	NKX61_RAT Homeobox protein Nkx-6.1 OS=Rattus norvegicus OX=10116 GN=Nkx6-1 PE=2 SV=1
10	Q60554	5.24e-55	182	364	0.460	0.335	NKX61_MESAU Homeobox protein Nkx-6.1 OS=Mesocricetus auratus OX=10036 GN=NKX6-1 PE=1 SV=1
11	Q9YHC2	6.18e-47	155	153	0.309	0.536	Q9YHC2_CHICK Homeodomain protein (Fragment) OS=Gallus gallus OX=9031 GN=Nkx-6.1 PE=2 SV=1
12	Q8SXK1	6.08e-33	127	480	0.219	0.121	Q8SXK1_DROME RE18506p OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
13	Q9NHP8	7.39e-33	127	513	0.219	0.113	Q9NHP8_DROME GTX/Nkx6B-like homeodomain protein OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
14	G5EGF2	5.39e-29	107	106	0.196	0.491	G5EGF2_CAEEL COG-1B OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
15	G5EGE2	4.78e-28	109	256	0.196	0.203	G5EGE2_CAEEL COG-1A OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
16	A9Y2A9	3.32e-18	84.0	282	0.155	0.145	A9Y2A9_DANRE Homeobox protein HMX1 OS=Danio rerio OX=7955 GN=Nkx5-3 PE=2 SV=1
17	Q8CF07	3.34e-18	82.8	214	0.260	0.322	Q8CF07_MOUSE Homeobox protein Nkx-6.2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=2 SV=1
18	P42581	3.47e-17	82.0	356	0.147	0.110	HMX3_MOUSE Homeobox protein HMX3 OS=Mus musculus OX=10090 GN=Hmx3 PE=1 SV=3
19	P43345	1.00e-16	80.5	332	0.151	0.120	TLX1_MOUSE T-cell leukemia homeobox protein 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1
20	Q9QX99	1.31e-16	80.1	333	0.147	0.117	Q9QX99_MOUSE T-cell leukemia, homeobox 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	3.3e+02	12.6	Homeobox KN domain
2	PF00046 Homeodomain	6.4e-18	75.7	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000053180

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000034321	0.547	Docking protein 2, 56kDa
2	9598.ENSPTRP00000055450	0.541	Uncharacterized protein
3	9598.ENSPTRP00000041603	0.521	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.995	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.989	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0005515	0.950	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.958	cellular process
GO:0032502	0.925	developmental process
GO:0048856	0.889	anatomical structure development
GO:0019222	0.845	regulation of metabolic process
GO:0060255	0.839	regulation of macromolecule metabolic process
GO:0032501	0.828	multicellular organismal process
GO:0048519	0.820	negative regulation of biological process
GO:0048522	0.796	positive regulation of cellular process
GO:0010468	0.766	regulation of gene expression
GO:0048731	0.746	system development
GO:0048523	0.710	negative regulation of cellular process
GO:0080090	0.700	regulation of primary metabolic process
GO:0031323	0.700	regulation of cellular metabolic process
GO:0006357	0.692	regulation of transcription by RNA polymerase II
GO:0048513	0.662	animal organ development
GO:0048869	0.611	cellular developmental process
GO:0030154	0.582	cell differentiation
GO:0009890	0.430	negative regulation of biosynthetic process
GO:0045893	0.382	positive regulation of DNA-templated transcription
GO:0031324	0.342	negative regulation of cellular metabolic process
GO:0051172	0.341	negative regulation of nitrogen compound metabolic process
GO:0010605	0.323	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.341	cytoplasm
GO:0070013	0.330	intracellular organelle lumen
GO:0031981	0.320	nuclear lumen
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]