StarFunc result for job id A6NJG6

User Input

>input (315 residues)
MRNRMAPENPQPDPFINRNYSNMKVIPPQDPASPSFTLLSKLECSGTVSAYCSLNLPGST
DPPTSASRVAATTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPES
TVKVWFRNRRFKLKKQQQQQSAKQRNQILPSKKNVPTSPRTSPSPYAFSPVISDFYSSLP
SQPLDPSNWAWNSTFTESSTSDFQMQDTQWERLVASVPALYSDAYDIFQIIELYNLPDEN
EISSSSFHCLYQYLSPTKYQVGGQGSSLSIFAGPAVGLSPAQTWPNMTSQAFEAYSLTDS
LEFQKTSNMVDLGFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NJG6	1.000	1.000	1.070E-45	315	1.000	1.000	A6NJG6.pdb.gz	ARGFX_HUMAN Arginine-fifty homeobox OS=Homo sapiens OX=9606 GN=ARGFX PE=2 SV=1
2	AFDB:O43186	0.249	0.262	6.375E-9	299	0.317	0.334	O43186.pdb.gz	CRX_HUMAN Cone-rod homeobox protein OS=Homo sapiens OX=9606 GN=CRX PE=1 SV=1
3	AFDB:Q9PT61	0.234	0.253	1.573E-7	290	0.251	0.272	Q9PT61.pdb.gz	OTX5B_XENLA Homeobox protein otx5-B OS=Xenopus laevis OX=8355 GN=otx5-b PE=2 SV=1
4	AFDB:P32243	0.244	0.265	1.900E-7	289	0.273	0.298	P32243.pdb.gz	OTX2_HUMAN Homeobox protein OTX2 OS=Homo sapiens OX=9606 GN=OTX2 PE=1 SV=1
5	AFDB:A8MZ59	0.274	0.418	2.771E-7	198	0.197	0.313	A8MZ59.pdb.gz	LEUTX_HUMAN Paired-like homeodomain transcription factor LEUTX OS=Homo sapiens OX=9606 GN=LEUTX PE=1 SV=4
6	AFDB:F1R982	0.242	0.264	2.771E-7	289	0.270	0.294	F1R982.pdb.gz
7	AFDB:P22810	0.247	0.152	4.302E-7	542	0.219	0.127	P22810.pdb.gz	HMOC_DROME Homeotic protein ocelliless OS=Drosophila melanogaster OX=7227 GN=oc PE=2 SV=2
8	AFDB:P56673	0.231	0.234	1.513E-6	311	0.210	0.212	P56673.pdb.gz	PITX1_CHICK Pituitary homeobox 1 OS=Gallus gallus OX=9031 GN=PITX1 PE=2 SV=1
9	AFDB:Q2NKI2	0.207	0.193	1.715E-6	338	0.206	0.192	Q2NKI2.pdb.gz	VAX1_MOUSE Ventral anterior homeobox 1 OS=Mus musculus OX=10090 GN=Vax1 PE=2 SV=2
10	AFDB:D3ZS29	0.242	0.244	2.836E-6	312	0.175	0.176	D3ZS29.pdb.gz	D3ZS29_RAT Nanog homeobox OS=Rattus norvegicus OX=10116 GN=Nanog PE=4 SV=1
11	PDB:4egcA	0.136	0.079	5.659E-2	539	0.035	0.020	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.124	0.479	8.251E-2	73	0.060	0.260	2hi3A.pdb.gz
13	PDB:7fbyA	0.113	0.215	6.569E-1	153	0.032	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:7b93E	0.088	0.122	1.687	215	0.035	0.051	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
15	PDB:2cg4A	0.106	0.210	2.037	149	0.029	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:7dcoL	0.106	0.079	2.789	435	0.054	0.039	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
17	PDB:4ldzA	0.162	0.251	3.586	196	0.029	0.046	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
18	PDB:3femA	0.098	0.109	3.819	281	0.025	0.028	3femA.pdb.gz
19	PDB:5z56L	0.114	0.105	3.819	342	0.054	0.050	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:5nr5A	0.124	0.316	4.611	113	0.025	0.071	5nr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJG6	0.0	646	315	1.000	1.000	ARGFX_HUMAN Arginine-fifty homeobox OS=Homo sapiens OX=9606 GN=ARGFX PE=2 SV=1
2	O43186	2.07e-30	118	299	0.302	0.318	CRX_HUMAN Cone-rod homeobox protein OS=Homo sapiens OX=9606 GN=CRX PE=1 SV=1
3	O54751	3.78e-30	117	299	0.302	0.318	CRX_MOUSE Cone-rod homeobox protein OS=Mus musculus OX=10090 GN=Crx PE=1 SV=1
4	Q9XSK0	4.14e-29	115	299	0.292	0.308	CRX_BOVIN Cone-rod homeobox protein OS=Bos taurus OX=9913 GN=CRX PE=1 SV=1
5	Q9JLT8	1.65e-28	113	299	0.302	0.318	Q9JLT8_RAT Homeodomain protein CRX OS=Rattus norvegicus OX=10116 GN=Crx PE=2 SV=1
6	Q9WTQ9	1.83e-28	113	299	0.302	0.318	Q9WTQ9_RAT Cone-rod homeobox OS=Rattus norvegicus OX=10116 GN=Crx PE=4 SV=1
7	Q91813	2.57e-19	88.2	288	0.273	0.299	OTX2A_XENLA Homeobox protein OTX2-A OS=Xenopus laevis OX=8355 GN=otx2-a PE=1 SV=1
8	P32243	1.20e-17	83.6	289	0.267	0.291	OTX2_HUMAN Homeobox protein OTX2 OS=Homo sapiens OX=9606 GN=OTX2 PE=1 SV=1
9	P80206	2.83e-17	82.4	289	0.263	0.287	OTX2_MOUSE Homeobox protein OTX2 OS=Mus musculus OX=10090 GN=Otx2 PE=1 SV=1
10	P32242	6.84e-17	82.4	354	0.117	0.105	OTX1_HUMAN Homeobox protein OTX1 OS=Homo sapiens OX=9606 GN=OTX1 PE=1 SV=1
11	Q91994	1.19e-16	81.3	323	0.117	0.115	OTX1B_DANRE Homeobox protein OTX1 B OS=Danio rerio OX=7955 GN=otx1b PE=2 SV=1
12	Q9PVM0	1.20e-16	80.9	290	0.257	0.279	OTX5A_XENLA Homeobox protein otx5-A OS=Xenopus laevis OX=8355 GN=otx5-a PE=2 SV=1
13	Q91981	1.40e-16	80.5	289	0.251	0.273	OTX2_DANRE Homeobox protein OTX2 OS=Danio rerio OX=7955 GN=otx2 PE=2 SV=1
14	Q9PT61	1.68e-16	80.5	290	0.251	0.272	OTX5B_XENLA Homeobox protein otx5-B OS=Xenopus laevis OX=8355 GN=otx5-b PE=2 SV=1
15	Q6NYT9	1.81e-16	80.1	289	0.137	0.149	Q6NYT9_DANRE Orthodenticle homolog 5 OS=Danio rerio OX=7955 GN=cb828 PE=2 SV=1
16	P80205	3.06e-16	80.5	355	0.114	0.101	OTX1_MOUSE Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=Otx1 PE=2 SV=1
17	Q9WUI0	8.72e-15	74.3	231	0.121	0.165	MIXL1_MOUSE Homeobox protein MIXL1 OS=Mus musculus OX=10090 GN=Mixl1 PE=1 SV=1
18	P54366	9.53e-15	76.6	415	0.105	0.080	GSC_DROME Homeobox protein goosecoid OS=Drosophila melanogaster OX=7227 GN=Gsc PE=2 SV=2
19	Q1LVQ7	2.09e-14	74.7	320	0.162	0.159	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
20	F1RCT9	2.14e-14	74.3	280	0.124	0.139	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.7e-13	61.5	Homeodomain
2	PF13916 Phostensin_N	3.8e+02	12.9	PP1-regulatory protein, Phostensin N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323455	0.803	Tetra-peptide repeat homeobox protein 1
2	9606.ENSP00000452398	0.776	Double homeobox protein A
3	9606.ENSP00000360455	0.662	Rhox homeobox family member 2B
4	9606.ENSP00000361373	0.619	Krueppel-like factor 17
5	9606.ENSP00000371553	0.612	NANOG neighbor homeobox
6	9606.ENSP00000360441	0.509	Rhox homeobox family member 2
7	9606.ENSP00000359392	0.506	KHDC3-like protein
8	9606.ENSP00000359415	0.506	Putative KHDC1-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.940	protein binding
GO:0140110	0.915	transcription regulator activity
GO:0003700	0.881	DNA-binding transcription factor activity
GO:0000981	0.586	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.483	transcription cis-regulatory region binding
GO:0000977	0.320	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0010468	0.988	regulation of gene expression
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0032501	0.975	multicellular organismal process
GO:0019219	0.936	regulation of nucleobase-containing compound metabolic process
GO:0048856	0.911	anatomical structure development
GO:2001141	0.898	regulation of RNA biosynthetic process
GO:0006355	0.867	regulation of DNA-templated transcription
GO:0048518	0.709	positive regulation of biological process
GO:0007275	0.644	multicellular organism development
GO:0009987	0.537	cellular process
GO:0009893	0.507	positive regulation of metabolic process
GO:0010604	0.503	positive regulation of macromolecule metabolic process
GO:0048731	0.473	system development
GO:0048522	0.424	positive regulation of cellular process
GO:0006357	0.414	regulation of transcription by RNA polymerase II
GO:0031325	0.392	positive regulation of cellular metabolic process
GO:0051173	0.391	positive regulation of nitrogen compound metabolic process
GO:0048513	0.361	animal organ development
GO:0045935	0.307	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.956	nuclear lumen
GO:0043232	0.879	intracellular non-membrane-bounded organelle
GO:0005654	0.444	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]