StarFunc result for job id A6NJQ4

User Input

>input (464 residues)
MMARRDPKSWAKRLVRAQTLQKQRRAPVGPSAPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRGEANPGPLNKDKGEKEERPRQQDPQRKALLHM
FSGKPPEKPLPNGKGSTESSDHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVL
ASLSPLRKASLSSSSSLGPKERQTGAAADIPQPAVRHQGREPLLVVKPTHSRPEGGCREV
PQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSID
RQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.471	0.471	3.380E-57	464	0.922	0.922	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:Q6FUW3	0.064	0.036	1.623E-1	975	0.140	0.067	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
3	AFDB:Q8IXK0	0.067	0.041	2.422E-1	858	0.181	0.098	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
4	AFDB:Q9QX47	0.068	0.018	9.194E-1	2444	0.166	0.032	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
5	PDB:6edtJ	0.066	0.220	9.935E-1	109	0.024	0.101	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
6	AFDB:Q9QWH1	0.059	0.038	1.051	850	0.185	0.101	Q9QWH1.pdb.gz	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
7	AFDB:D4A7V6	0.067	0.023	1.123	1962	0.181	0.043	D4A7V6.pdb.gz	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1
8	AFDB:Q92540	0.103	0.051	1.123	1137	0.188	0.077	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
9	AFDB:Q8N1G0	0.097	0.043	1.201	1237	0.168	0.063	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
10	AFDB:A0A0A0MSI2	0.058	0.041	1.283	830	0.157	0.088	A0A0A0MSI2.pdb.gz	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
11	AFDB:H3BJD6	0.071	0.033	1.283	1292	0.136	0.049	H3BJD6.pdb.gz	H3BJD6_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
12	PDB:6i9ra	0.060	0.256	1.387	83	0.013	0.072	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
13	PDB:7y9tA	0.052	0.063	1.811	380	0.015	0.018	7y9tA.pdb.gz
14	PDB:5hutA	0.040	0.040	2.070	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
15	PDB:4v8mBj	0.052	0.141	2.365	161	0.013	0.037	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
16	PDB:3sucA	0.045	0.028	2.528	767	0.015	0.009	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
17	PDB:2k8pA	0.048	0.095	3.301	189	0.056	0.138	2k8pA.pdb.gz
18	PDB:6yxyBA	0.034	0.021	3.301	769	0.022	0.013	6yxyBA.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:7mq8L8	0.038	0.097	3.529	180	0.013	0.033	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:3zqjF	0.046	0.036	3.772	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	804	464	0.922	0.922	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P04590	0.27	36.2	522	0.088	0.079	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
6	P03348	0.42	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
7	P04585	0.49	35.4	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
8	P03366	0.54	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
9	P05888	0.93	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
10	Q72497	1.1	34.3	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	1.2	33.9	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	G5EF97	3.3	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
13	P12497	4.7	32.3	1435	0.060	0.020	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
14	P35963	5.7	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
15	Q1LYC2	7.0	32.0	1947	0.034	0.008	Q1LYC2_DANRE Transcription initiation factor TFIID subunit OS=Danio rerio OX=7955 GN=wu:fi04f03 PE=1 SV=1
16	Q80UV9	9.8	31.2	1891	0.024	0.006	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2
17	A0A8I6A7M0	10.0	31.2	1893	0.024	0.006	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	1e+02	14.4	Zinc knuckle
2	PF15288 zf-CCHC_6	2.4e-19	80.2	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.387	catalytic activity
GO:0016740	0.303	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0071704	0.979	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0065007	0.956	biological regulation
GO:0050794	0.954	regulation of cellular process
GO:0019222	0.867	regulation of metabolic process
GO:0043170	0.861	macromolecule metabolic process
GO:0031323	0.857	regulation of cellular metabolic process
GO:0019219	0.831	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.822	regulation of macromolecule metabolic process
GO:0048518	0.810	positive regulation of biological process
GO:0048522	0.791	positive regulation of cellular process
GO:0031325	0.717	positive regulation of cellular metabolic process
GO:0051252	0.713	regulation of RNA metabolic process
GO:0044260	0.675	cellular macromolecule metabolic process
GO:0010468	0.651	regulation of gene expression
GO:0010556	0.633	regulation of macromolecule biosynthetic process
GO:0031326	0.633	regulation of cellular biosynthetic process
GO:0006355	0.617	regulation of DNA-templated transcription
GO:0010604	0.614	positive regulation of macromolecule metabolic process
GO:0051173	0.526	positive regulation of nitrogen compound metabolic process
GO:0045935	0.505	positive regulation of nucleobase-containing compound metabolic process
GO:1901360	0.475	organic cyclic compound metabolic process
GO:0006725	0.475	cellular aromatic compound metabolic process
GO:1901564	0.473	organonitrogen compound metabolic process
GO:0046483	0.467	heterocycle metabolic process
GO:0006139	0.459	nucleobase-containing compound metabolic process
GO:0090304	0.377	nucleic acid metabolic process
GO:1903508	0.340	positive regulation of nucleic acid-templated transcription
GO:0045893	0.320	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005654	0.979	nucleoplasm
GO:0005694	0.941	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.303	Transferases.

[back to server]