StarFunc result for job id A6NJR5

User Input

>input (290 residues)
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLC
GLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPR
KVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRV
SDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSR
IPLIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPEHWVWARDRARLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NLX3	0.552	0.665	1.182E-24	237	0.531	0.650	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
2	AFDB:Q5IBH6	0.535	0.576	1.739E-24	268	0.500	0.541	Q5IBH6.pdb.gz	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
3	AFDB:P0DTA3	0.524	0.570	3.021E-24	265	0.603	0.660	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	AFDB:Q9PU13	0.455	0.442	2.420E-14	299	0.272	0.264	Q9PU13.pdb.gz	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
5	AFDB:Q9YGL1	0.461	0.449	2.558E-14	298	0.276	0.268	Q9YGL1.pdb.gz	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
6	AFDB:A0A384MTT5	0.455	0.422	7.024E-13	313	0.217	0.201	A0A384MTT5.pdb.gz	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
7	AFDB:Q5IBH7	0.458	0.429	6.870E-11	310	0.231	0.216	Q5IBH7.pdb.gz	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
8	AFDB:A0A0R4IWM8	0.259	0.156	5.947E-3	525	0.141	0.078	A0A0R4IWM8.pdb.gz
9	AFDB:P24869	0.220	0.137	1.239E-1	491	0.117	0.069	P24869.pdb.gz	CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLB2 PE=1 SV=1
10	AFDB:Q39070	0.199	0.141	1.239E-1	429	0.141	0.096	Q39070.pdb.gz	CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-2 PE=1 SV=2
11	PDB:7kpvB	0.258	0.258	1.538E-1	290	0.059	0.059	7kpvB.pdb.gz
12	PDB:1zp2A	0.259	0.318	2.527E-1	227	0.055	0.070	1zp2A.pdb.gz
13	PDB:1sqfA	0.202	0.154	1.400	425	0.055	0.038	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
14	PDB:6kvgA	0.197	0.220	1.479	256	0.062	0.070	6kvgA.pdb.gz
15	PDB:3f29B	0.100	0.068	1.845	520	0.066	0.037	3f29B.pdb.gz	Binding of sulfite by the Thioalkalivibrio nitratireducens cytochrome c nitrite reductase
16	PDB:2w8qA	0.101	0.067	1.950	485	0.066	0.039	2w8qA.pdb.gz	Redox-Switch Modulation of Human Ssadh by Dynamic Catalytic Loop.
17	PDB:5iy6U	0.089	0.128	1.950	170	0.072	0.124	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
18	PDB:2pk9D	0.196	0.243	2.060	219	0.052	0.068	2pk9D.pdb.gz
19	PDB:3jcmI	0.123	0.098	2.060	416	0.072	0.050	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
20	PDB:6jhoA	0.127	0.161	2.177	200	0.048	0.070	6jhoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q495Y8	1.03e-159	452	402	0.903	0.652	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
2	P0CI01	7.75e-157	445	402	0.897	0.647	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
3	P0DTA3	5.29e-114	331	265	0.600	0.657	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	A6NLX3	2.74e-92	275	237	0.521	0.637	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	3.23e-84	255	268	0.455	0.493	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9PU13	1.19e-30	118	299	0.272	0.264	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q9YGL1	2.43e-29	115	298	0.266	0.258	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
8	Q5MJ68	5.28e-27	108	293	0.214	0.212	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q5IBH7	6.07e-21	92.4	310	0.228	0.213	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	A0A384MTT5	1.99e-20	91.3	313	0.197	0.182	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
11	Q5MJ70	1.99e-20	91.3	313	0.197	0.182	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
12	Q4R1K5	2.86e-20	90.9	311	0.197	0.183	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
13	Q9FNQ1	3.2	32.0	2157	0.086	0.012	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
14	P03317	7.9	30.8	2513	0.062	0.007	POLN_SINDV Polyprotein P1234 OS=Sindbis virus OX=11034 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	9.2e-55	195.9	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258704

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378699	0.880	Cyclin-dependent kinase 1
2	9606.ENSP00000266970	0.804	Cyclin-dependent kinase 2
3	9606.ENSP00000485271	0.709	annotation not available
4	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
5	9606.ENSP00000392726	0.522	POM121-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019901	0.374	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.986	regulation of metabolic process
GO:0031399	0.979	regulation of protein modification process
GO:0051726	0.975	regulation of cell cycle
GO:0042325	0.963	regulation of phosphorylation
GO:0051338	0.961	regulation of transferase activity
GO:0048522	0.919	positive regulation of cellular process
GO:0009987	0.813	cellular process
GO:0045787	0.603	positive regulation of cell cycle
GO:0045859	0.589	regulation of protein kinase activity
GO:0031325	0.442	positive regulation of cellular metabolic process
GO:1904029	0.438	regulation of cyclin-dependent protein kinase activity
GO:0071900	0.415	regulation of protein serine/threonine kinase activity
GO:0000079	0.412	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0008152	0.382	metabolic process
GO:0051247	0.375	positive regulation of protein metabolic process
GO:0071704	0.372	organic substance metabolic process
GO:0051347	0.369	positive regulation of transferase activity
GO:0031401	0.364	positive regulation of protein modification process
GO:0010562	0.352	positive regulation of phosphorus metabolic process
GO:0042327	0.341	positive regulation of phosphorylation
GO:0006807	0.330	nitrogen compound metabolic process
GO:0001934	0.323	positive regulation of protein phosphorylation
GO:0043170	0.317	macromolecule metabolic process
GO:0045737	0.314	positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0007049	0.305	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.992	cytoplasm
GO:0043233	0.985	organelle lumen
GO:0005654	0.970	nucleoplasm
GO:0005829	0.941	cytosol
GO:0043232	0.754	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]