StarFunc result for job id A6NJT0

User Input

>input (531 residues)
MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAASVPFSIDGLLGG
SCAAAASVVNPTPLLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFTGWQLEEL
EKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPT
TCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQGRHLHSPGGLSLHSAPSSDSDSGGG
GLSPEPPEPPPPAAKGPGAHASGAAGTAPAPPGEPPAPGTCDPAFYPSQRSGAGPQPRPG
RPADKDAASCGPGAAVAAVERGAAGLPKASPFSVESLLSDSPPRRKAASNAAAAAAAGLD
FAPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGLEPAPKDAPPAPAVPPAPP
AQASFGAFSGPGGAPDSAFARRSPDAVASPGAPAPAPAPFRDLASAAATEGGGGDCADAG
TAGPAPPPPAPSPRPGPRPPSPAEEPATCGVPEPGAAAGPSPPEGEELDMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NJT0	0.999	0.999	3.010E-73	531	1.000	1.000	A6NJT0.pdb.gz	UNC4_HUMAN Homeobox protein unc-4 homolog OS=Homo sapiens OX=9606 GN=UNCX PE=3 SV=1
2	AFDB:O08934	0.284	0.285	2.077E-60	530	0.881	0.883	O08934.pdb.gz	UNC4_MOUSE Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2
3	AFDB:Q8VIH1	0.121	0.121	3.861E-10	527	0.232	0.233	Q8VIH1.pdb.gz	NOBOX_MOUSE Homeobox protein NOBOX OS=Mus musculus OX=10090 GN=Nobox PE=1 SV=1
4	AFDB:A7YYJ6	0.108	0.125	1.357E-6	454	0.137	0.161	A7YYJ6.pdb.gz
5	AFDB:P81066	0.095	0.106	1.044E-5	474	0.162	0.181	P81066.pdb.gz	IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 OS=Mus musculus OX=10090 GN=Irx2 PE=2 SV=2
6	AFDB:P31264	0.130	0.092	2.155E-5	782	0.185	0.125	P31264.pdb.gz	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
7	AFDB:Q9JKQ4	0.095	0.104	1.118E-4	484	0.177	0.194	Q9JKQ4.pdb.gz	IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus OX=10090 GN=Irx5 PE=2 SV=1
8	AFDB:F1NPG5	0.080	0.069	4.178E-3	639	0.162	0.135	F1NPG5.pdb.gz	CENPT_CHICK Centromere protein T OS=Gallus gallus OX=9031 GN=CENPT PE=1 SV=2
9	AFDB:Q93Z00	0.071	0.075	4.766E-3	489	0.166	0.180	Q93Z00.pdb.gz	TCP14_ARATH Transcription factor TCP14 OS=Arabidopsis thaliana OX=3702 GN=TCP14 PE=1 SV=1
10	AFDB:Q382N7	0.076	0.088	5.090E-3	444	0.141	0.169	Q382N7.pdb.gz	Q382N7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0016 PE=4 SV=1
11	PDB:2hi3A	0.102	0.644	7.566E-3	73	0.045	0.329	2hi3A.pdb.gz
12	PDB:4egcA	0.096	0.094	3.016E-2	539	0.026	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:6xywBD	0.087	0.208	1.784E-1	210	0.032	0.081	6xywBD.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
14	PDB:7fbyA	0.078	0.233	8.664E-1	153	0.019	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:6id0L	0.095	0.105	9.253E-1	475	0.043	0.048	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:2rvqD	0.055	0.163	1.467	129	0.028	0.116	2rvqD.pdb.gz
17	PDB:5fywR	0.068	0.173	1.674	199	0.024	0.065	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
18	PDB:7od1A	0.041	0.049	1.674	430	0.034	0.042	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
19	PDB:5aj0BZ	0.083	0.382	1.909	86	0.026	0.163	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:5mrca	0.079	0.205	2.178	177	0.024	0.073	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJT0	0.0	1028	531	1.000	1.000	UNC4_HUMAN Homeobox protein unc-4 homolog OS=Homo sapiens OX=9606 GN=UNCX PE=3 SV=1
2	O08934	0.0	709	530	0.881	0.883	UNC4_MOUSE Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2
3	O96616	1.58e-42	157	349	0.154	0.235	O96616_DROME Paired-type homeobox protein OS=Drosophila melanogaster OX=7227 GN=OdsH PE=2 SV=1
4	Q9VX20	2.20e-42	157	382	0.154	0.215	Q9VX20_DROME IP01524p OS=Drosophila melanogaster OX=7227 GN=OdsH PE=2 SV=2
5	P29506	1.09e-34	133	252	0.107	0.226	UNC4_CAEEL Homeobox protein unc-4 OS=Caenorhabditis elegans OX=6239 GN=unc-4 PE=1 SV=2
6	Q9H161	8.05e-27	114	411	0.089	0.114	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
7	O35137	9.13e-27	114	399	0.089	0.118	ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus OX=10090 GN=Alx4 PE=1 SV=1
8	Q06453	1.99e-26	113	408	0.104	0.135	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
9	O42115	2.85e-26	113	453	0.087	0.102	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
10	A6YP92	3.93e-26	114	566	0.098	0.092	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
11	Q96QS3	5.20e-26	114	562	0.098	0.093	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
12	O35085	5.93e-26	114	564	0.098	0.092	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
13	Q15699	7.26e-26	110	326	0.094	0.153	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
14	V9HWA7	7.26e-26	110	326	0.094	0.153	V9HWA7_HUMAN Cartilage paired-class homeoprotein 1 OS=Homo sapiens OX=9606 GN=HEL23 PE=2 SV=1
15	Q8C8B0	1.32e-25	109	326	0.090	0.147	ALX1_MOUSE ALX homeobox protein 1 OS=Mus musculus OX=10090 GN=Alx1 PE=1 SV=1
16	Q63087	1.37e-25	109	326	0.090	0.147	ALX1_RAT ALX homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Alx1 PE=1 SV=1
17	Q8T0V5	2.21e-25	109	357	0.085	0.126	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
18	Q9XZU0	2.30e-25	109	357	0.085	0.126	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
19	O42357	4.66e-25	108	327	0.089	0.144	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
20	Q1LVQ7	4.81e-25	107	320	0.089	0.147	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	2.9e-19	80.0	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314480

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381499	0.713	Paired box protein Pax-1
2	9606.ENSP00000342392	0.711	Mesoderm posterior protein 2
3	9606.ENSP00000222725	0.690	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
4	9606.ENSP00000358677	0.635	T-box transcription factor TBX18
5	9606.ENSP00000446205	0.630	Transcription factor HES-7
6	9606.ENSP00000399547	0.617	Ankyrin repeat domain-containing protein 63
7	9606.ENSP00000276173	0.582	Protein ripply1
8	9606.ENSP00000361868	0.577	Zinc finger matrin-type 1
9	9606.ENSP00000380053	0.575	PRD class homeoboxes and pseudogenes
10	9606.ENSP00000452871	0.564	Transducin-like enhancer protein 3
11	9606.ENSP00000281047	0.563	Mesogenin-1
12	9606.ENSP00000358703	0.543	Protein ripply2
13	9606.ENSP00000365682	0.543	Transducin-like enhancer protein 1
14	9606.ENSP00000356864	0.539	Microsomal glutathione S-transferase 3
15	9606.ENSP00000365720	0.539	Transducin-like enhancer protein 4
16	9606.ENSP00000264779	0.538	Vasculin
17	9606.ENSP00000355245	0.529	Paired box protein Pax-9
18	9606.ENSP00000343899	0.510	FERM domain containing 6
19	9606.ENSP00000355718	0.505	Delta-like protein 1
20	9606.ENSP00000359474	0.501	BarH-like 2 homeobox protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.957	DNA-binding transcription factor activity
GO:0005515	0.945	protein binding
GO:0000981	0.831	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.498	transcription cis-regulatory region binding
GO:0000977	0.402	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0048856	0.984	anatomical structure development
GO:0050794	0.978	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0007275	0.950	multicellular organism development
GO:0060255	0.889	regulation of macromolecule metabolic process
GO:0048731	0.871	system development
GO:0010468	0.855	regulation of gene expression
GO:0048513	0.671	animal organ development
GO:0009653	0.603	anatomical structure morphogenesis
GO:0080090	0.410	regulation of primary metabolic process
GO:0031323	0.401	regulation of cellular metabolic process
GO:0048519	0.394	negative regulation of biological process
GO:0051171	0.390	regulation of nitrogen compound metabolic process
GO:0019219	0.359	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.356	positive regulation of biological process
GO:0048869	0.332	cellular developmental process
GO:0048523	0.332	negative regulation of cellular process
GO:0030154	0.324	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.784	organelle lumen
GO:0070013	0.753	intracellular organelle lumen
GO:0031981	0.520	nuclear lumen
GO:0005654	0.501	nucleoplasm
GO:0005737	0.374	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]