StarFunc result for job id A6NJU9

User Input

>input (1138 residues)
MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPW
LHVIIAFPTSYKVVITLWIVYLWVSLLKTIFWSRNGHDGSTDVQQRAWRSNRRRQEGLRS
ICMHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINHHDKINGKRKTAR
KQKMFQRAQELRRRAEDYHKCKIPPSARKALCNWVRMAAAEHRHSSGLPYWPYLTAETLK
NRMGHQPPPPTQQHSITDNSLSLKTPPECVLTPLPPSADDNLKTPPECVLTPLPPSADDN
LKTPPECLLTPLPPSADDNLKTPPECLLTPLPPSADDNLKTPPECLLTPLPPSAPPSAPP
SADDNLKTRAECLLHPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLP
PSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPL
PPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAER
LRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAFHPQRMIISRHLPSVSSLPF
HPQLHSQQMIISRYLLSVCGFRFHHQPMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSV
CGGRFHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLPS
VSSLPFHPQLHPQQMIISRHLPSVCGERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSA
DDNIKTPAERLRRPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPS
ADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPP
SAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLR
GPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPPLAT
QEAEAEKPRKPKRQRAAEMEPPPEPKRRRVGDVEPSRKPKRRRAADVEPSSPKPKRRRVG
DVEPSRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKPKRRRAADVEPSSPEPKRRRLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NJU9	0.999	0.999	0.000	1138	1.000	1.000	A6NJU9.pdb.gz	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
2	AFDB:C9JG80	0.228	0.228	0.000	1138	0.882	0.882	C9JG80.pdb.gz	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
3	AFDB:Q92617	0.186	0.198	0.000	1050	0.873	0.947	Q92617.pdb.gz	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
4	AFDB:E5RHQ5	0.115	0.113	2.725E-103	1161	0.865	0.848	E5RHQ5.pdb.gz	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
5	AFDB:F8W0I5	0.167	0.196	5.294E-98	928	0.776	0.952	F8W0I5.pdb.gz	NPB12_HUMAN Nuclear pore complex-interacting protein family member B12 OS=Homo sapiens OX=9606 GN=NPIPB12 PE=3 SV=2
6	AFDB:Q96M83	0.044	0.038	3.375E-5	1385	0.156	0.129	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
7	AFDB:Q54G14	0.042	0.042	1.144E-3	1081	0.094	0.099	Q54G14.pdb.gz	Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290685 PE=2 SV=2
8	AFDB:Q381S5	0.044	0.044	1.295E-3	1172	0.149	0.145	Q381S5.pdb.gz	Q381S5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6740 PE=4 SV=1
9	AFDB:Q580U4	0.046	0.028	1.558E-3	2128	0.182	0.097	Q580U4.pdb.gz	Q580U4_TRYB2 Paraflagellar rod protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.480 PE=4 SV=1
10	AFDB:A6NGG8	0.055	0.050	1.658E-3	1288	0.163	0.144	A6NGG8.pdb.gz	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
11	PDB:6uxwA	0.036	0.040	2.337	778	0.029	0.042	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
12	PDB:6ahrJ	0.026	0.081	4.612	247	0.010	0.045	6ahrJ.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
13	PDB:2jkyA	0.042	0.146	5.219	207	0.010	0.053	2jkyA.pdb.gz	Functional Significance of Four Successive Glycine Residues in the Pyrophosphate Binding Loop of Fungal 6-Oxopurine Phosphoribosyltransferases.
14	PDB:6zwmG	0.021	0.149	6.683	98	0.014	0.163	6zwmG.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
15	PDB:3tv0A	0.025	0.135	8.045	143	0.011	0.091	3tv0A.pdb.gz
16	PDB:3ct7A	0.024	0.080	9.103	219	0.007	0.037	3ct7A.pdb.gz	Structural basis for substrate specificity in phosphate binding (beta/alpha)8-barrels: D-allulose 6-phosphate 3-epimerase from Escherichia coli K-12.
17	PDB:5u6yA	0.026	0.049	9.103	459	0.011	0.026	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJU9	0.0	2227	1138	1.000	1.000	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
2	A8MRT5	0.0	1702	1133	0.892	0.896	NPIB5_HUMAN Nuclear pore complex-interacting protein family member B5 OS=Homo sapiens OX=9606 GN=NPIPB5 PE=2 SV=3
3	C9JG80	0.0	1700	1138	0.896	0.896	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
4	E5RHQ5	0.0	1584	1161	0.865	0.848	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
5	E9PKP1	0.0	1170	595	0.519	0.993	E9PKP1_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
6	F5H4N5	0.0	744	358	0.312	0.992	F5H4N5_HUMAN Nuclear pore complex interacting protein family member B3 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB3 PE=3 SV=1
7	F6SDX0	0.0	1170	595	0.519	0.993	F6SDX0_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
8	F8W0I5	0.0	763	928	0.472	0.579	NPB12_HUMAN Nuclear pore complex-interacting protein family member B12 OS=Homo sapiens OX=9606 GN=NPIPB12 PE=3 SV=2
9	Q92617	0.0	1553	1050	0.827	0.896	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
10	E9PQR5	1.10e-175	524	432	0.253	0.667	NPIB8_HUMAN Nuclear pore complex-interacting protein family member B8 OS=Homo sapiens OX=9606 GN=NPIPB8 PE=3 SV=1
11	E9PJ23	1.41e-172	516	425	0.240	0.642	NPIB6_HUMAN Nuclear pore complex-interacting protein family member B6 OS=Homo sapiens OX=9606 GN=NPIPB6 PE=3 SV=1
12	E9PNV8	5.13e-161	484	369	0.234	0.721	E9PNV8_HUMAN Nuclear pore complex interacting protein family member A3 OS=Homo sapiens OX=9606 GN=NPIPA3 PE=3 SV=1
13	E9PIF3	2.64e-153	464	369	0.228	0.702	NPIA2_HUMAN Nuclear pore complex-interacting protein family member A2 OS=Homo sapiens OX=9606 GN=NPIPA2 PE=3 SV=1
14	A6NJ64	1.83e-151	460	397	0.216	0.620	NPIB2_HUMAN Putative nuclear pore complex-interacting protein family member B2 OS=Homo sapiens OX=9606 GN=NPIPB2 PE=5 SV=4
15	A6NHN6	3.71e-144	442	443	0.214	0.551	NPB15_HUMAN Nuclear pore complex-interacting protein family member B15 OS=Homo sapiens OX=9606 GN=NPIPB15 PE=3 SV=3
16	A0A0B4J1W7	7.23e-144	439	369	0.209	0.645	NPIA9_HUMAN Nuclear pore complex-interacting protein family member A9 OS=Homo sapiens OX=9606 GN=NPIPA9 PE=3 SV=1
17	F8W1W9	6.65e-143	439	429	0.218	0.578	NPIB9_HUMAN Nuclear pore complex-interacting protein family member B9 OS=Homo sapiens OX=9606 GN=NPIPB9 PE=3 SV=1
18	I3L0I5	1.18e-141	435	421	0.216	0.584	I3L0I5_HUMAN Nuclear pore complex interacting protein family member B7 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB7 PE=3 SV=2
19	A0A1B0GW90	1.54e-141	433	370	0.199	0.611	A0A1B0GW90_HUMAN Uncharacterized protein (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
20	O75200	5.85e-141	433	414	0.216	0.594	NPIB7_HUMAN Nuclear pore complex-interacting protein family member B7 OS=Homo sapiens OX=9606 GN=NPIPB7 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06409 NPIP	1e-166	564.3	Nuclear pore complex interacting protein (NPIP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440703

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396234	0.681	DEP domain containing 4
2	9606.ENSP00000328444	0.595	Keratin-associated protein 4-8
3	9606.ENSP00000478606	0.561	Protocadherin beta-9
4	9606.ENSP00000309501	0.558	NACHT and WD repeat domain containing 2
5	9606.ENSP00000485357	0.556	Hemicentin-2
6	9606.ENSP00000380495	0.519	ATP-dependent RNA helicase DDX51
7	9606.ENSP00000249014	0.504	Cdc42 effector protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.721	biological regulation
GO:0009987	0.541	cellular process
GO:0050789	0.506	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.435	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]