StarFunc result for job id A6NJZ7

User Input

>input (1639 residues)
MAKDSPSPLGASPKKPGCSSPAAAVLENQRRELEKLRAELEAERAGWRAERRRFAARERQ
LREEAERERRQLADRLRSKWEAQRSRELRQLQEEMQREREAEIRQLLRWKEAEQRQLQQL
LHRERDGVVRQARELQRQLAEELVNRGHCSRPGASEVSAAQCRCRLQEVLAQLRWQTDGE
QAARIRYLQAALEVERQLFLKYILAHFRGHPALSGSPDPQAVHSLEEPLPQTSSGSCHAP
KPACQLGSLDSLSAEVGVRSRSLGLVSSACSSSPDGLLSTHASSLDCFAPACSRSLDSTR
SLPKASKSEERPSSPDTSTPGSRRLSPPPSPLPPPPPPSAHRKLSNPRGGEGSESQPCEV
LTPSPPGLGHHELIKLNWLLAKALWVLARRCYTLQEENKQLRRAGCPYQADEKVKRLKVK
RAELTGLARRLADRARELQETNLRAVSAPIPGESCAGLELCQVFARQRARDLSEQASAPL
AKDKQIEELRQECHLLQARVASGPCSDLHTGRGGPCTQWLNVRDLDRLQRESQREVLRLQ
RQLMLQQGNGGAWPEAGGQSATCEEVRRQMLALERELDQRRRECQELGTQAAPARRRGEE
AETQLQAALLKNAWLAEENGRLQAKTDWVRKVEAENSEVRGHLGRACQERDASGLIAEQL
LQQAARGQDRQQQLQRDPQKALCDLHPSWKEIQALQCRPGHPPEQPWETSQMPESQVKGS
RRPKFHARPEDYAVSQPNRDIQEKREASLEESPVALGESASVPQVSETVPASQPLSKKTS
SQSNSSSEGSMWATVPSSPTLDRDTASEVDDLEPDSVSLALEMGGSAAPAAPKLKIFMAQ
YNYNPFEGPNDHPEGELPLTAGDYIYIFGDMDEDGFYEGELDDGRRGLVPSNFVEQIPDS
YIPGCLPAKSPDLGPSQLPAGQDEALEEDSLLSGKAQGMVDRGLCQMVRVGSKTEVATEI
LDTKTEACQLGLLQSMGKQGLSRPLLGTKGVLRMAPMQLHLQNVTATSANITWVYSSHRH
PHVVYLDDREHALTPAGVSCYTFQGLCPGTHYRVRVEVRLPWDLLQVYWGTMSSTVTFDT
LLAGPPYPPLDVLVERHASPGVLVVSWLPVTIDSAGSSNGVQVTGYAVYADGLKVCEVAD
ATAGSTVLEFSQLQVPLTWQKVSVRTMSLCGESLDSVPAQIPEDFFMCHRWPETPPFSYT
CGDPSTYRVTFPVCPQKLSLAPPSAKASPHNPGSCGEPQAKFLEAFFEEPPRRQSPVSNL
GSEGECPSSGAGSQAQELAEAWEGCRKDLLFQKSPQNHRPPSVSDQPGEKENCYQHMGTS
KSPAPGFIHLRTECGPRKEPCQEKAALERVLRQKQDAQGFTPPQLGASQQYASDFHNVLK
EEQEALCLDLRGTERREERREPEPHSRQGQALGVKRGCQLHEPSSALCPAPSAKVIKMPR
GGPQQLGTGANTPARVFVALSDYNPLVMSANLKAAEEELVFQKRQLLRVWGSQDTHDFYL
SECNRQVGNIPGRLVAEMEVGTEQTDRRWRSPAQGHLPSVAHLEDFQGLIIPQGSSLVLQ
GNSKRLPLWTPKIMIAALDYDPGDGQMGGQGKGRLALRAGDVVMVYGPMDDQGFYYGELG
GHRGLVPAHLLDHMSLHGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3V0F0	0.144	0.145	0.000	1606	0.630	0.643	Q3V0F0.pdb.gz	RIMB3_MOUSE RIMS-binding protein 3 OS=Mus musculus OX=10090 GN=Rimbp3 PE=1 SV=2
2	AFDB:Q9UFD9	0.163	0.163	0.000	1639	0.992	0.992	Q9UFD9.pdb.gz	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
3	AFDB:O95153	0.114	0.101	4.363E-74	1857	0.317	0.280	O95153.pdb.gz	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
4	AFDB:Q9JIR0	0.109	0.098	1.860E-72	1847	0.310	0.275	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
5	AFDB:P48681	0.047	0.047	4.084E-10	1621	0.168	0.170	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
6	AFDB:P97603	0.091	0.105	4.084E-10	1377	0.066	0.078	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
7	AFDB:Q9VPZ7	0.078	0.091	2.667E-9	1342	0.065	0.079	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
8	AFDB:Q9Z2I4	0.080	0.093	1.251E-8	1366	0.067	0.081	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
9	AFDB:F1NY98	0.074	0.062	2.055E-8	2034	0.056	0.045	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
10	AFDB:Q9W1X4	0.035	0.034	4.212E-8	1711	0.140	0.134	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
11	PDB:7u7nC	0.071	0.364	7.806E-7	200	0.023	0.190	7u7nC.pdb.gz
12	PDB:8dtlA	0.074	0.141	8.248E-7	741	0.020	0.045	8dtlA.pdb.gz
13	PDB:2lqnA	0.044	0.186	9.734E-7	303	0.024	0.132	2lqnA.pdb.gz
14	PDB:7z0lB	0.067	0.211	1.029E-6	370	0.020	0.089	7z0lB.pdb.gz
15	PDB:8eyyA	0.074	0.135	1.432E-6	775	0.019	0.040	8eyyA.pdb.gz
16	PDB:6pxvA	0.073	0.127	2.227E-6	823	0.024	0.047	6pxvA.pdb.gz
17	PDB:5mj3A	0.061	0.241	6.108E-5	302	0.018	0.099	5mj3A.pdb.gz
18	PDB:2eyzA	0.037	0.177	8.049E-5	304	0.026	0.141	2eyzA.pdb.gz
19	PDB:6pyhD	0.074	0.137	8.988E-5	798	0.028	0.058	6pyhD.pdb.gz
20	PDB:1k9aB	0.036	0.127	1.561E-4	441	0.010	0.039	1k9aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V0F0	0.0	1816	1606	0.625	0.638	RIMB3_MOUSE RIMS-binding protein 3 OS=Mus musculus OX=10090 GN=Rimbp3 PE=1 SV=2
2	Q9UFD9	0.0	3303	1639	0.993	0.993	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
3	Q9JIR0	7.70e-64	243	1847	0.133	0.118	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
4	O15034	1.10e-57	221	1052	0.090	0.141	RIMB2_HUMAN RIMS-binding protein 2 OS=Homo sapiens OX=9606 GN=RIMBP2 PE=1 SV=3
5	Q7TNF8	7.26e-55	214	1846	0.092	0.082	RIMB1_MOUSE Peripheral-type benzodiazepine receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 SV=2
6	O95153	2.00e-45	183	1857	0.069	0.061	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
7	Q80U40	2.56e-32	139	1072	0.057	0.087	RIMB2_MOUSE RIMS-binding protein 2 OS=Mus musculus OX=10090 GN=Rimbp2 PE=1 SV=3
8	Q9JIR1	2.25e-31	136	1049	0.056	0.088	RIMB2_RAT RIMS-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Rimbp2 PE=1 SV=2
9	A0A0B4JDC9	1.20e-16	89.0	1844	0.037	0.033	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
10	A0A0B4JCX2	1.30e-16	89.0	1817	0.037	0.034	A0A0B4JCX2_DROME RIM-binding protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
11	A0A0B4KG12	1.31e-16	89.0	1799	0.037	0.034	A0A0B4KG12_DROME RIM-binding protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
12	A0A126GUV2	1.32e-16	89.0	1765	0.037	0.035	A0A126GUV2_DROME RIM-binding protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
13	Q86BP0	1.38e-16	89.0	1487	0.037	0.041	Q86BP0_DROME RIM-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
14	E1JIL7	1.53e-16	88.6	1791	0.037	0.034	E1JIL7_DROME RIM-binding protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
15	Q9VF66	1.58e-16	88.6	1748	0.037	0.035	Q9VF66_DROME RIM-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=5
16	A0A0B4KGQ6	1.63e-16	88.6	1763	0.037	0.035	A0A0B4KGQ6_DROME RIM-binding protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
17	Q86BS0	1.81e-16	88.6	1473	0.038	0.043	Q86BS0_DROME RIM-binding protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
18	Q9N415	3.31e-16	87.4	1276	0.043	0.055	Q9N415_CAEEL Variant SH3 domain protein OS=Caenorhabditis elegans OX=6239 GN=rimb-1 PE=1 SV=3
19	A0A0B4LFQ2	0.002	45.1	754	0.021	0.046	A0A0B4LFQ2_DROME Inner centromere protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Incenp PE=1 SV=1
20	Q557J6	0.002	45.4	481	0.016	0.054	DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum OX=44689 GN=abpE-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	4.7	18.9	Fibronectin type III domain
2	PF00018 SH3_1	0.014	26.3	SH3 domain
3	PF07653 SH3_2	1.5e-19	80.9	Variant SH3 domain
4	PF14604 SH3_9	1.8e-14	64.7	Variant SH3 domain
5	PF02080 TrkA_C	7.3e+02	11.5	TrkA-C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390630

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483386	0.807	RIMS-binding protein 3A
2	9606.ENSP00000479326	0.801	Probable component of the manchette, a microtubule-based structure which plays a key role in sperm head morphogenesis during late stages of sperm development
3	9606.ENSP00000357238	0.572	TSSK6-activating co-chaperone protein
4	9606.ENSP00000249079	0.556	UPF0193 protein EVG1
5	9606.ENSP00000409937	0.532	C2 calcium-dependent domain-containing protein 6
6	9606.ENSP00000344579	0.524	Fibrous sheath CABYR-binding protein
7	9606.ENSP00000404432	0.520	LIM and senescent cell antigen-like domains 3-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048232	0.994	male gamete generation
GO:0009987	0.989	cellular process
GO:0007283	0.983	spermatogenesis
GO:0022412	0.976	cellular process involved in reproduction in multicellular organism
GO:0048869	0.936	cellular developmental process
GO:0030154	0.899	cell differentiation
GO:0048856	0.840	anatomical structure development
GO:0065007	0.649	biological regulation
GO:0007281	0.629	germ cell development
GO:0009566	0.596	fertilization
GO:0050789	0.588	regulation of biological process
GO:0048515	0.558	spermatid differentiation
GO:0050794	0.503	regulation of cellular process
GO:0007286	0.366	spermatid development
GO:0071840	0.311	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.999	cytoskeleton
GO:0005634	0.999	nucleus
GO:0005737	0.940	cytoplasm
GO:0015630	0.885	microtubule cytoskeleton
GO:0070013	0.339	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]