StarFunc result for job id A6NK06

User Input

>input (481 residues)
MMLKSITESFATAIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTTTEVFHIASQYSKIY
SSNISSTVWGQPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALP
RSPKFSGLDLLLAFNVGIEVQGRLLHFAKEANDMPKRFHPPSVVGTLGSAAAASKFLGLS
STKCREALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLGLQGNKQVLDLEA
GFGAFYANYSPKVLPSIASYSWLLDQQDVAFKRFPAHLSTHWVADAAASVRKHLVAERAL
LPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSFHECQINRP
QVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEE
KFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNL
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NK06	1.000	1.000	2.355E-83	481	1.000	1.000	A6NK06.pdb.gz	IRG1_HUMAN Cis-aconitate decarboxylase OS=Homo sapiens OX=9606 GN=ACOD1 PE=1 SV=1
2	PDB:6r6uA	0.947	0.994	2.167E-77	458	0.952	1.000	6r6uA.pdb.gz	Crystal structure ofcis-aconitate decarboxylase reveals the impact of naturally occurring human mutations on itaconate synthesis.
3	AFDB:P54987	0.957	0.943	9.727E-73	488	0.815	0.803	P54987.pdb.gz	IRG1_MOUSE Cis-aconitate decarboxylase OS=Mus musculus OX=10090 GN=Acod1 PE=1 SV=2
4	PDB:7br9B	0.938	0.996	7.749E-67	453	0.796	0.845	7br9B.pdb.gz
5	AFDB:A0A2R8RL39	0.924	0.925	5.455E-55	480	0.557	0.558	A0A2R8RL39.pdb.gz
6	AFDB:A0JMM8	0.933	0.901	1.995E-54	498	0.530	0.512	A0JMM8.pdb.gz	A0JMM8_DANRE Immunoresponsive gene 1,-like OS=Danio rerio OX=7955 GN=zgc:154020 PE=2 SV=1
7	AFDB:Q0C8L3	0.865	0.850	1.611E-25	490	0.220	0.216	Q0C8L3.pdb.gz	CAD_ASPTN Cis-aconitate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cad1 PE=1 SV=1
8	AFDB:Q8NSH9	0.809	0.784	1.163E-21	498	0.225	0.217	Q8NSH9.pdb.gz	PRPD1_CORGL 2-methylcitrate dehydratase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=prpD1 PE=3 SV=1
9	AFDB:Q937N6	0.765	0.760	3.681E-21	484	0.189	0.188	Q937N6.pdb.gz	PRPD_CUPNE 2-methylcitrate dehydratase OS=Cupriavidus necator OX=106590 GN=prpD PE=3 SV=1
10	AFDB:O06582	0.804	0.739	9.168E-21	526	0.212	0.194	O06582.pdb.gz	PRPD_MYCTU 2-methylcitrate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=prpD PE=1 SV=1
11	AFDB:Q12428	0.822	0.769	1.631E-20	516	0.204	0.190	Q12428.pdb.gz	PRPD_YEAST Probable 2-methylcitrate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDH1 PE=1 SV=1
12	AFDB:P74840	0.771	0.768	1.977E-20	483	0.193	0.193	P74840.pdb.gz	PRPD_SALTY 2-methylcitrate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=prpD PE=1 SV=2
13	PDB:1szqA	0.709	0.720	9.619E-20	473	0.202	0.205	1szqA.pdb.gz
14	PDB:1ygyA	0.159	0.147	6.538E-2	527	0.046	0.042	1ygyA.pdb.gz
15	PDB:1q32B	0.092	0.101	1.552E-1	420	0.042	0.048	1q32B.pdb.gz
16	PDB:3hjaA	0.101	0.138	2.279E-1	334	0.037	0.054	3hjaA.pdb.gz	Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Borrelia burgdorferi
17	PDB:7jwkC	0.098	0.131	2.509E-1	333	0.042	0.060	7jwkC.pdb.gz	Crystal Structure of Glyceraldehyde-3-phosphate Dehydrogenase (GAPDH) from Mycoplasma genitalium with bound NAD
18	PDB:4aicA	0.105	0.128	2.761E-1	379	0.054	0.069	4aicA.pdb.gz	Structures of Mycobacterium Tuberculosis 1-Deoxy-D-Xylulose- 5-Phosphate Reductoisomerase Provide New Insights Into Catalysis.
19	PDB:1cerO	0.096	0.130	3.189E-1	331	0.040	0.057	1cerO.pdb.gz	Determinants of enzyme thermostability observed in the molecular structure of Thermus aquaticus D-glyceraldehyde-3-phosphate dehydrogenase at 25 Angstroms Resolution.
20	PDB:7odrk	0.106	0.388	4.683E-1	101	0.023	0.109	7odrk.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NK06	0.0	996	481	1.000	1.000	IRG1_HUMAN Cis-aconitate decarboxylase OS=Homo sapiens OX=9606 GN=ACOD1 PE=1 SV=1
2	P54987	0.0	820	488	0.819	0.807	IRG1_MOUSE Cis-aconitate decarboxylase OS=Mus musculus OX=10090 GN=Acod1 PE=1 SV=2
3	A0JMM8	2.94e-179	513	498	0.532	0.514	A0JMM8_DANRE Immunoresponsive gene 1,-like OS=Danio rerio OX=7955 GN=zgc:154020 PE=2 SV=1
4	B0UYM1	1.04e-177	508	477	0.559	0.564	B0UYM1_DANRE Aconitate decarboxylase 1 OS=Danio rerio OX=7955 GN=irg1 PE=3 SV=1
5	Q0C8L3	1.46e-16	84.3	490	0.239	0.235	CAD_ASPTN Cis-aconitate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cad1 PE=1 SV=1
6	Q8NSH9	3.54e-07	55.1	498	0.210	0.203	PRPD1_CORGL 2-methylcitrate dehydratase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=prpD1 PE=3 SV=1
7	Q8NSL3	1.42e-06	53.1	504	0.222	0.212	PRPD2_CORGL 2-methylcitrate dehydratase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=prpD2 PE=2 SV=1
8	Q12428	2.26e-05	49.3	516	0.164	0.153	PRPD_YEAST Probable 2-methylcitrate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDH1 PE=1 SV=1
9	P77243	4.68e-05	48.1	483	0.193	0.193	PRPD_ECOLI 2-methylcitrate dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=prpD PE=1 SV=3
10	P74840	1.24e-04	47.0	483	0.195	0.195	PRPD_SALTY 2-methylcitrate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=prpD PE=1 SV=2
11	Q937N6	2.84e-04	45.8	484	0.198	0.196	PRPD_CUPNE 2-methylcitrate dehydratase OS=Cupriavidus necator OX=106590 GN=prpD PE=3 SV=1
12	Q0PBF4	0.60	34.3	223	0.044	0.094	Q0PBF4_CAMJE Two-component regulator OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=Cj0355c PE=4 SV=1
13	O60061	1.4	33.5	322	0.042	0.062	ALG5_SCHPO Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
14	O06582	1.6	33.9	526	0.102	0.093	PRPD_MYCTU 2-methylcitrate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=prpD PE=1 SV=1
15	Q84M24	1.8	33.9	1882	0.069	0.018	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
16	Q5ZSD5	2.0	33.5	912	0.035	0.019	Q5ZSD5_LEGPH SidF, inhibitor of growth family, member 3 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=sidF PE=1 SV=1
17	H8F0D6	2.4	33.1	505	0.102	0.097	PRPD_MYCTE 2-methylcitrate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=ERDMAN_1266 PE=1 SV=1
18	Q05BE5	8.8	31.2	483	0.031	0.031	Q05BE5_HUMAN DEAH (Asp-Glu-Ala-His) box polypeptide 33, isoform CRA_c OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15115 HDNR	2.9e+02	13.1	Domain of unknown function with conserved HDNR motif
2	PF03972 MmgE_PrpD	6.6e-78	272.9	MmgE/PrpD N-terminal domain
3	PF19305 MmgE_PrpD_C	1.5e-32	124.3	MmgE/PrpD C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245206	0.910	Aspartate aminotransferase, mitochondrial
2	9606.ENSP00000263341	0.778	Interleukin-1 beta
3	9606.ENSP00000342056	0.661	Citrate synthase, mitochondrial
4	9606.ENSP00000482259	0.657	C-C motif chemokine 4
5	9606.ENSP00000315474	0.633	GTPase IMAP family member 7
6	9606.ENSP00000297770	0.617	Carboxypeptidase A6
7	9606.ENSP00000299663	0.588	C-type lectin domain family 4 member E
8	9606.ENSP00000446743	0.575	Uncharacterized protein
9	9606.ENSP00000483609	0.552	C-C motif chemokine 4-like
10	9606.ENSP00000305651	0.548	C-X-C motif chemokine 10
11	9606.ENSP00000354511	0.541	Catechol O-methyltransferase
12	9606.ENSP00000216254	0.539	Aconitate hydratase, mitochondrial
13	9606.ENSP00000362179	0.536	Endoribonuclease ZC3H12A
14	9606.ENSP00000360869	0.523	Interferon-induced protein with tetratricopeptide repeats 1
15	9606.ENSP00000224356	0.522	Cytochrome P450 26A1
16	9606.ENSP00000341944	0.516	Leucine-rich repeat-containing protein 66
17	9606.ENSP00000309477	0.507	Cytoplasmic aconitate hydratase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047613	1.000	aconitate decarboxylase activity
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0051707	0.962	response to other organism
GO:0032101	0.960	regulation of response to external stimulus
GO:0006952	0.959	defense response
GO:0009617	0.952	response to bacterium
GO:0051716	0.946	cellular response to stimulus
GO:0042221	0.945	response to chemical
GO:0048518	0.905	positive regulation of biological process
GO:0002682	0.878	regulation of immune system process
GO:0010033	0.867	response to organic substance
GO:0031347	0.865	regulation of defense response
GO:0048584	0.863	positive regulation of response to stimulus
GO:0070887	0.860	cellular response to chemical stimulus
GO:0048519	0.849	negative regulation of biological process
GO:0002376	0.839	immune system process
GO:0098542	0.836	defense response to other organism
GO:0002684	0.803	positive regulation of immune system process
GO:0023051	0.802	regulation of signaling
GO:0010646	0.797	regulation of cell communication
GO:0009966	0.790	regulation of signal transduction
GO:0071310	0.753	cellular response to organic substance
GO:0050776	0.719	regulation of immune response
GO:0032103	0.718	positive regulation of response to external stimulus
GO:0048523	0.658	negative regulation of cellular process
GO:0019222	0.629	regulation of metabolic process
GO:0031323	0.487	regulation of cellular metabolic process
GO:0031349	0.477	positive regulation of defense response
GO:0009889	0.448	regulation of biosynthetic process
GO:0050778	0.430	positive regulation of immune response
GO:0002237	0.382	response to molecule of bacterial origin
GO:1901700	0.361	response to oxygen-containing compound
GO:0002831	0.354	regulation of response to biotic stimulus
GO:0048522	0.308	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0043233	0.428	organelle lumen
GO:0070013	0.423	intracellular organelle lumen
GO:0005634	0.405	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15253	1.000	cis-aconitate + H(+) = CO2 + itaconate
EC:4.1.1.6	1.000	cis-aconitate decarboxylase.

[back to server]