StarFunc result for job id A6NK53

User Input

>input (670 residues)
MTKFQEMVTFKDVAVVFTREELGLLDLAQRKLYQDVMLENFRNLLSVGYQPFKLDVILQL
GKEDKLRMMETEIQGDGCSGHKNQNEIDTLQEVRLRFLSYEDLICWQIWEQFTSKLTSNQ
DLIINLQGKRSKLLKQGDSPCQVWTGESSQVSEDENYVIKLQGESSNSIKNQELPLRTTW
DFWRKMYLREPQNYQSRCQQIDVKNKLCKCDHCVRQRIAHQHDDHGVHKREKAFSHNNCG
KDCVKESSQHSIIQSGEQTSDENGKGLSVGSNLELHQQLHLRDKPHVNVEYGKGIGYSSG
LPRHQCFHIGEKCYRNGDSGEGFSQGSHLQPHQRVSTGENLYRCQVYARSSNQNSCLPSH
ELTHPGEKLCTCGRCGKGFHHSLDFDIHCVDSAGERACKCDVYDKGFSQTSQLQAHQRGH
SRDKTYKWEVSDRIFNRNSGLHQRVHTGEKPYKCEVCDKGFSKASNLQAHQRIHTGEKPY
KCDVCDKNFSRNSHLQAHQRVHTGEKPYKCDTCGKDFSQISHLQAHQRVHKGEKPYKCET
CGKGFSQSSHLQDHQQVHTGENPYKCDVCGKGFSWSSHLQAHQRVHTGEKPYKCEECRKG
FIWNSYLHVHQRIHTGEKPYKCGMCGKSFSQTSHLQAHQRVHTGEKPYKCFVCGKGFSKS
SLSSDSSESP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WZ6	0.328	0.277	2.127E-51	799	0.518	0.434	Q86WZ6.pdb.gz	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
2	AFDB:Q02386	0.333	0.327	2.526E-51	682	0.472	0.463	Q02386.pdb.gz	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
3	AFDB:Q9R164	0.325	0.311	7.996E-45	701	0.413	0.395	Q9R164.pdb.gz	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
4	AFDB:Q12901	0.334	0.408	8.394E-44	538	0.373	0.465	Q12901.pdb.gz	ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens OX=9606 GN=ZNF155 PE=1 SV=4
5	AFDB:Q9P2J8	0.319	0.251	4.146E-42	865	0.360	0.279	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
6	AFDB:Q06732	0.327	0.283	1.164E-41	778	0.382	0.329	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
7	AFDB:Q14587	0.311	0.225	2.598E-41	947	0.349	0.247	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
8	AFDB:Q6NX49	0.317	0.298	1.029E-40	715	0.352	0.330	Q6NX49.pdb.gz	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
9	AFDB:Q6P1L6	0.330	0.368	3.059E-40	599	0.315	0.352	Q6P1L6.pdb.gz	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
10	AFDB:A0A024R4S7	0.322	0.275	3.633E-40	792	0.366	0.309	A0A024R4S7.pdb.gz
11	PDB:3w5kB	0.077	0.275	5.411E-4	110	0.060	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.048	0.108	1.111	208	0.042	0.135	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6ydhA	0.030	0.194	1.111	62	0.021	0.226	6ydhA.pdb.gz
14	PDB:5gm6a	0.035	0.119	1.567	123	0.037	0.203	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:7dvqM	0.035	0.095	1.660	191	0.051	0.178	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:5c8dE	0.054	0.098	1.972	280	0.028	0.068	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
17	PDB:6ke6RC	0.059	0.122	2.626	278	0.025	0.061	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
18	PDB:7uhyA	0.043	0.040	2.945	771	0.037	0.032	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7kpxC	0.067	0.047	4.660	1352	0.073	0.036	7kpxC.pdb.gz
20	PDB:7uhyC	0.037	0.042	4.660	578	0.028	0.033	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02386	0.0	543	682	0.476	0.468	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
2	Q86WZ6	0.0	589	799	0.504	0.423	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
3	Q99K53	8.83e-171	506	700	0.467	0.447	Q99K53_MOUSE Zfp111 protein OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
4	Q9R164	3.99e-168	499	701	0.463	0.442	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
5	Q9UJW7	9.48e-167	500	825	0.445	0.361	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
6	A8K8Y5	1.27e-166	496	707	0.454	0.430	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
7	Q9NZL3	6.48e-166	494	707	0.454	0.430	ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens OX=9606 GN=ZNF224 PE=1 SV=3
8	Q62788	1.89e-161	484	744	0.466	0.419	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
9	G3V9G6	8.64e-160	479	740	0.461	0.418	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
10	Q9UK10	3.04e-155	466	706	0.439	0.416	ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens OX=9606 GN=ZNF225 PE=1 SV=2
11	A0A8I6G8Y2	1.01e-149	453	723	0.443	0.411	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
12	Q96NJ3	1.31e-148	446	590	0.425	0.483	ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens OX=9606 GN=ZNF285 PE=1 SV=3
13	Q6ECI4	4.11e-138	423	717	0.393	0.367	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
14	Q8TAQ5	1.23e-136	418	688	0.401	0.391	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
15	Q9P2J8	6.01e-136	422	865	0.401	0.311	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
16	Q9UK13	4.54e-135	412	617	0.388	0.421	ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens OX=9606 GN=ZNF221 PE=1 SV=4
17	Q05481	4.87e-130	414	1191	0.396	0.223	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
18	P35789	8.48e-130	398	620	0.379	0.410	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	Q8IYB9	1.21e-128	396	648	0.364	0.377	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
20	A6NNF4	1.88e-128	394	616	0.384	0.417	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	0.081	24.6	BolA-like protein
2	PF01352 KRAB	1.5e-18	77.4	KRAB box
3	PF00096 zf-C2H2	3.9e-35	129.5	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	1.2e-12	58.5	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	42	15.6	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	2.4e-14	64.4	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	2.5e-59	206.5	Zinc-finger double domain
8	PF12874 zf-met	0.0031	29.0	Zinc-finger of C2H2 type
9	PF09723 Zn-ribbon_8	32	16.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375820

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313110	0.636	Olfactory receptor 6S1
2	9606.ENSP00000396234	0.567	DEP domain containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0031323	0.948	regulation of cellular metabolic process
GO:0048519	0.858	negative regulation of biological process
GO:0009889	0.808	regulation of biosynthetic process
GO:0051171	0.798	regulation of nitrogen compound metabolic process
GO:0010556	0.774	regulation of macromolecule biosynthetic process
GO:0031326	0.774	regulation of cellular biosynthetic process
GO:0019219	0.759	regulation of nucleobase-containing compound metabolic process
GO:0031324	0.750	negative regulation of cellular metabolic process
GO:0051172	0.711	negative regulation of nitrogen compound metabolic process
GO:0009890	0.613	negative regulation of biosynthetic process
GO:0010605	0.608	negative regulation of macromolecule metabolic process
GO:0006355	0.579	regulation of DNA-templated transcription
GO:0010558	0.426	negative regulation of macromolecule biosynthetic process
GO:0045934	0.426	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.425	negative regulation of cellular biosynthetic process
GO:0051253	0.358	negative regulation of RNA metabolic process
GO:0045892	0.334	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031974	0.943	membrane-enclosed lumen
GO:0070013	0.927	intracellular organelle lumen
GO:0031981	0.921	nuclear lumen
GO:0005737	0.858	cytoplasm
GO:0005654	0.679	nucleoplasm
GO:0071944	0.459	cell periphery
GO:0005886	0.452	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]