StarFunc result for job id A6NK58

User Input

>input (231 residues)
MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAG
LRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLE
ACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFE
HIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NK58	1.000	1.000	2.924E-54	231	1.000	1.000	A6NK58.pdb.gz	LIPT2_HUMAN Putative lipoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=LIPT2 PE=1 SV=1
2	AFDB:Q9D009	0.974	0.974	3.380E-47	231	0.844	0.844	Q9D009.pdb.gz	LIPT2_MOUSE Putative lipoyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Lipt2 PE=1 SV=2
3	AFDB:Q9SXP7	0.828	0.814	2.646E-24	235	0.368	0.362	Q9SXP7.pdb.gz	LIP2M_ARATH Octanoyltransferase LIP2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LIP2 PE=1 SV=1
4	AFDB:O36017	0.798	0.840	4.962E-22	219	0.312	0.329	O36017.pdb.gz	LIPB_SCHPO Probable octanoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.05c PE=3 SV=1
5	AFDB:P60720	0.837	0.904	6.776E-22	213	0.273	0.296	P60720.pdb.gz	LIPB_ECOLI Octanoyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=lipB PE=1 SV=1
6	AFDB:Q948J9	0.858	0.719	1.345E-21	278	0.294	0.245	Q948J9.pdb.gz	LIP2P_ARATH Octanoyltransferase LIP2p, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIP2P PE=1 SV=1
7	AFDB:P9WK83	0.798	0.801	3.879E-21	230	0.385	0.387	P9WK83.pdb.gz	LIPB_MYCTU Octanoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipB PE=1 SV=1
8	PDB:1w66A	0.781	0.826	1.221E-20	218	0.364	0.385	1w66A.pdb.gz	The Mycobacterium Tuberculosis Lipb Enzyme Functions as a Cysteine/Lysine Dyad Acyltransferase.
9	AFDB:Q06005	0.817	0.587	3.041E-19	328	0.290	0.204	Q06005.pdb.gz	LIPB_YEAST Octanoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LIP2 PE=1 SV=1
10	AFDB:Q383Z0	0.763	0.673	5.327E-19	265	0.294	0.257	Q383Z0.pdb.gz	Q383Z0_TRYB2 lipoyl(octanoyl) transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1160 PE=3 SV=1
11	AFDB:Q8IB70	0.757	0.422	2.398E-15	434	0.195	0.104	Q8IB70.pdb.gz	Q8IB70_PLAF7 Lipoate-protein ligase B OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0823600 PE=4 SV=2
12	PDB:3a7aA	0.659	0.472	1.109E-10	337	0.195	0.134	3a7aA.pdb.gz	Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
13	PDB:3r07A	0.695	0.636	1.515E-10	255	0.173	0.157	3r07A.pdb.gz
14	PDB:4xtuA	0.430	0.384	4.704E-6	266	0.152	0.132	4xtuA.pdb.gz	Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
15	PDB:2cghA	0.308	0.301	1.448E-4	238	0.117	0.113	2cghA.pdb.gz
16	PDB:2ewnA	0.444	0.344	2.240E-4	318	0.126	0.091	2ewnA.pdb.gz	Co-repressor Induced Order and Biotin Repressor Dimerization: A Case for Divergent Followed by Convergent Evolution.
17	PDB:1bibA	0.441	0.362	2.874E-4	294	0.130	0.102	1bibA.pdb.gz	Escherichia coli biotin holoenzyme synthetase/bio repressor crystal structure delineates the biotin- and DNA-binding domains.
18	PDB:7uliAAA	0.185	0.126	8.874E-2	377	0.087	0.053	7uliAAA.pdb.gz
19	PDB:1nvmB	0.140	0.114	1.070E-1	312	0.074	0.054	1nvmB.pdb.gz	Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
20	PDB:3pvuA	0.143	0.070	2.724E-1	609	0.052	0.020	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NK58	4.81e-167	461	231	1.000	1.000	LIPT2_HUMAN Putative lipoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=LIPT2 PE=1 SV=1
2	Q9D009	1.10e-128	364	231	0.844	0.844	LIPT2_MOUSE Putative lipoyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Lipt2 PE=1 SV=2
3	Q9SXP7	2.66e-39	137	235	0.385	0.379	LIP2M_ARATH Octanoyltransferase LIP2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LIP2 PE=1 SV=1
4	O36017	3.82e-33	121	219	0.329	0.347	LIPB_SCHPO Probable octanoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.05c PE=3 SV=1
5	P9WK83	4.44e-27	105	230	0.368	0.370	LIPB_MYCTU Octanoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipB PE=1 SV=1
6	Q948J9	2.31e-24	99.8	278	0.255	0.212	LIP2P_ARATH Octanoyltransferase LIP2p, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIP2P PE=1 SV=1
7	Q06005	1.63e-19	87.4	328	0.247	0.174	LIPB_YEAST Octanoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LIP2 PE=1 SV=1
8	P60720	1.55e-17	80.1	213	0.203	0.221	LIPB_ECOLI Octanoyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=lipB PE=1 SV=1
9	Q383Z0	3.00e-16	77.4	265	0.281	0.245	Q383Z0_TRYB2 lipoyl(octanoyl) transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1160 PE=3 SV=1
10	Q8IB70	3.77e-08	55.5	434	0.139	0.074	Q8IB70_PLAF7 Lipoate-protein ligase B OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0823600 PE=4 SV=2
11	A1XXK1	1.5	32.0	306	0.087	0.065	A1XXK1_DROME Varicose (Fragment) OS=Drosophila melanogaster OX=7227 GN=vari PE=2 SV=1
12	A1XXK3	1.5	32.0	308	0.087	0.065	A1XXK3_DROME Varicose (Fragment) OS=Drosophila melanogaster OX=7227 GN=vari PE=2 SV=1
13	A1XXK4	1.8	32.0	285	0.087	0.070	A1XXK4_DROME Varicose (Fragment) OS=Drosophila melanogaster OX=7227 GN=vari PE=2 SV=1
14	A1XXK0	2.7	30.4	138	0.082	0.138	A1XXK0_DROME Varicose (Fragment) OS=Drosophila melanogaster OX=7227 GN=vari PE=2 SV=1
15	Q8SXI6	3.2	31.2	636	0.087	0.031	Q8SXI6_DROME RE31492p OS=Drosophila melanogaster OX=7227 GN=vari PE=2 SV=1
16	Q8IBA3	3.5	31.2	1397	0.078	0.013	Q8IBA3_PLAF7 Translation initiation factor IF-2, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0827100 PE=3 SV=1
17	A1XXK7	5.0	29.6	133	0.082	0.143	A1XXK7_DROME Varicose (Fragment) OS=Drosophila melanogaster OX=7227 GN=vari PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18215 Rtt106_N	7e+02	11.2	Histone chaperone Rtt106 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309463

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319531	0.995	Glycine cleavage system H protein, mitochondrial
2	9606.ENSP00000261434	0.994	Lipoyl synthase, mitochondrial
3	9606.ENSP00000377115	0.994	Lipoyltransferase 1, mitochondrial
4	9606.ENSP00000458770	0.956	Acyl carrier protein, mitochondrial
5	9606.ENSP00000280346	0.846	Dihydrolipoamide S-acetyltransferase
6	9606.ENSP00000280701	0.832	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
7	9606.ENSP00000263702	0.826	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
8	9606.ENSP00000304592	0.800	Fatty acid synthase
9	9606.ENSP00000331369	0.797	BolA-like protein 3
10	9606.ENSP00000387219	0.792	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
11	9606.ENSP00000372445	0.759	Methyltransferase-like protein 17, mitochondrial
12	9606.ENSP00000255416	0.740	Myosin-binding protein H
13	9606.ENSP00000355672	0.709	Putative transferase CAF17, mitochondrial
14	9606.ENSP00000205402	0.700	Dihydrolipoyl dehydrogenase, mitochondrial
15	9606.ENSP00000227868	0.678	Pyruvate dehydrogenase protein X component, mitochondrial
16	9606.ENSP00000353165	0.669	Thiamin pyrophosphokinase 1
17	9606.ENSP00000307241	0.657	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
18	9606.ENSP00000452007	0.652	Iron-sulfur cluster assembly 2 homolog, mitochondrial
19	9606.ENSP00000385312	0.647	Mitochondrial thiamine pyrophosphate carrier
20	9606.ENSP00000377311	0.642	Ferredoxin-2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033819	1.000	lipoyl(octanoyl) transferase activity
GO:0005515	0.510	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044281	0.988	small molecule metabolic process
GO:0036211	0.979	protein modification process
GO:0051604	0.974	protein maturation
GO:0018205	0.966	peptidyl-lysine modification
GO:0019752	0.965	carboxylic acid metabolic process
GO:0065007	0.901	biological regulation
GO:0050789	0.809	regulation of biological process
GO:0050794	0.789	regulation of cellular process
GO:0048518	0.617	positive regulation of biological process
GO:0048522	0.612	positive regulation of cellular process
GO:0019222	0.360	regulation of metabolic process
GO:0031323	0.343	regulation of cellular metabolic process
GO:0009893	0.300	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.950	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17665	1.000	L-lysyl-[protein] + octanoyl-[ACP] = H(+) + holo-[ACP] + N(6)-octanoyl-L-lysyl-[protein]
EC:2.3.1.181	1.000	lipoyl(octanoyl) transferase.

[back to server]