StarFunc result for job id A6NK75

User Input

>input (572 residues)
MPGPLGSLEMGVLTFRDVALEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFVGIAASKPD
LITCLEQGKEPWNVKRHEMVTEPPVVYSYFAQDLWPKQGKKNYFQKVILRTYKKCGRENL
QLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQYDKYVKVFHKFSNSNRHKIGHTGKK
SFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNEASNLSTHKRIHTGKKPYKC
EECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECG
RAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFS
RLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHAGEKFYKCEVCSKAFSRFSH
LTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCEECGKAFNQSSTLSKH
KVIHTGEKPYKCEECGKAFNQSSHLTTHKMIHTGEKPYKCEECGKAFNNSSILNRHKMIH
TGEKLYKPESCNNACDNIAKISKYKRNCAGEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8G1	0.579	0.581	9.940E-67	570	0.706	0.709	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
2	AFDB:Q14593	0.438	0.440	2.240E-66	569	0.701	0.705	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
3	AFDB:A6NNF4	0.531	0.422	1.137E-65	738	0.720	0.558	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	AFDB:Q05481	0.462	0.249	1.201E-65	1191	0.712	0.342	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
5	AFDB:Q03923	0.567	0.548	3.745E-65	595	0.731	0.703	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	AFDB:P35789	0.402	0.375	1.019E-63	620	0.706	0.652	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
7	AFDB:Q03936	0.516	0.506	7.765E-62	586	0.703	0.686	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
8	AFDB:O75437	0.491	0.436	1.750E-61	659	0.682	0.592	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
9	AFDB:Q8TD23	0.479	0.482	6.420E-61	568	0.694	0.699	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
10	AFDB:Q96JC4	0.521	0.563	3.938E-59	524	0.647	0.706	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
11	PDB:3w5kB	0.089	0.274	6.957E-4	110	0.075	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6r7iA	0.077	0.092	1.483E-1	426	0.089	0.120	6r7iA.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
13	PDB:7tveG	0.058	0.097	1.042	307	0.079	0.147	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
14	PDB:6f40P	0.060	0.108	1.891	246	0.044	0.102	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
15	PDB:7ena4	0.076	0.086	1.996	457	0.087	0.109	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:7jtkF	0.067	0.114	2.349	287	0.056	0.111	7jtkF.pdb.gz
17	PDB:5c8dE	0.064	0.104	3.079	280	0.037	0.075	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
18	PDB:6r5kO	0.067	0.077	3.079	447	0.049	0.063	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
19	PDB:2c1dA	0.055	0.099	3.251	264	0.019	0.042	2c1dA.pdb.gz	Structure of the Cytochrome Complex Soxxa of Paracoccus Pantotrophus, a Heme Enzyme Initiating Chemotrophic Sulfur Oxidation.
20	PDB:7ad8D	0.038	0.063	3.432	280	0.037	0.075	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	546	616	0.490	0.455	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	542	659	0.498	0.432	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	534	809	0.509	0.360	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	785	620	0.705	0.650	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	815	595	0.731	0.703	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	797	586	0.708	0.691	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	548	1191	0.510	0.245	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	785	569	0.701	0.705	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	578	474	0.507	0.612	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	822	569	0.701	0.705	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q49A12	681	536	0.622	0.664	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	Q5JVG8	596	444	0.512	0.660	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
13	Q6ZR52	536	646	0.495	0.438	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
14	Q8IW36	607	515	0.556	0.617	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
15	Q8IYB9	727	648	0.656	0.579	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	Q8IYN0	764	542	0.663	0.699	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
17	Q8IYX0	568	411	0.503	0.701	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
18	Q8TAQ5	543	688	0.498	0.414	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
19	Q8TD23	784	568	0.694	0.699	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
20	Q96H40	631	463	0.547	0.676	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	10	17.5	Rad4 beta-hairpin domain 1
2	PF01722 BolA	0.0013	30.4	BolA-like protein
3	PF07975 C1_4	0.084	24.4	TFIIH C1-like domain
4	PF04777 Evr1_Alr	2.4e+02	13.5	Erv1 / Alr family
5	PF07754 HVO_2753_ZBP	21	16.3	Small zinc finger protein HVO_2753-like, Zn-binding pocket
6	PF01352 KRAB	4.3e-19	79.2	KRAB box
7	PF01286 XPA_N	1.2e-15	68.6	XPA protein N-terminal
8	PF14149 YhfH	1.7e+02	13.6	YhfH-like protein
9	PF01428 zf-AN1	0.029	25.8	AN1-like Zinc finger
10	PF00096 zf-C2H2	4.1e-71	242.8	Zinc finger, C2H2 type
11	PF16622 zf-C2H2_11	5e-06	37.5	zinc-finger C2H2-type
12	PF13894 zf-C2H2_4	1.2e-38	139.4	C2H2-type zinc finger
13	PF13912 zf-C2H2_6	2.8e-24	95.8	C2H2-type zinc finger
14	PF12171 zf-C2H2_jaz	1.9e-18	77.5	Zinc-finger double-stranded RNA-binding
15	PF13465 zf-H2C2_2	4.8e-103	344.7	Zinc-finger double domain
16	PF02591 zf-RING_7	2.2e-06	39.0	C4-type zinc ribbon domain
17	PF18439 zf_UBZ	1.1e-12	58.6	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	5.8	19.1	zinc-ribbon family
19	PF09723 Zn-ribbon_8	1e-08	46.4	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	0.14	23.5	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251250	0.596	DTW domain containing 1
2	9606.ENSP00000330432	0.568	Protein FAM83F
3	9606.ENSP00000326095	0.516	E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates . In turn, participates in different biological processes including interferon production or autophagy . Plays a role in the activation of RNA virus-induced interferon-beta production by promoting the ubiquitination of TRAF3 and TRAF6 . Plays also a role in the early recruitment of autophagy adapters to bacteria . Mediates 'Lys-29' and 'Lys-33'-linked ubiquitination of SQSTM1 leading to xenophagic targeting of bacteria and inhibition of their replication
4	9606.ENSP00000448248	0.505	GLIPR1-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0010556	0.969	regulation of macromolecule biosynthetic process
GO:0031326	0.969	regulation of cellular biosynthetic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:2001141	0.947	regulation of RNA biosynthetic process
GO:0009892	0.873	negative regulation of metabolic process
GO:0010605	0.823	negative regulation of macromolecule metabolic process
GO:0010468	0.779	regulation of gene expression
GO:1903506	0.774	regulation of nucleic acid-templated transcription
GO:0009890	0.765	negative regulation of biosynthetic process
GO:0006355	0.757	regulation of DNA-templated transcription
GO:0009987	0.714	cellular process
GO:0045934	0.663	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.634	negative regulation of RNA metabolic process
GO:1903507	0.611	negative regulation of nucleic acid-templated transcription
GO:0045892	0.461	negative regulation of DNA-templated transcription
GO:0008152	0.450	metabolic process
GO:0044237	0.439	cellular metabolic process
GO:0034641	0.425	cellular nitrogen compound metabolic process
GO:0071704	0.319	organic substance metabolic process
GO:0044238	0.319	primary metabolic process
GO:0046483	0.317	heterocycle metabolic process
GO:0006139	0.313	nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.946	intracellular organelle lumen
GO:0031981	0.936	nuclear lumen
GO:0005654	0.922	nucleoplasm
GO:0005737	0.365	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]