StarFunc result for job id A6NK89

User Input

>input (507 residues)
MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRRRQRRSRRLGSAGDPHG
PGELPEPPNEDDEDDDEALPQGMLCGPPQCYCIVEKWRGFERILPNKTRILRLWAAWGEE
QENVRFVLVRSEASLPNAGPRSAEARVVLSRERPCPARGAPARPSLAMTQEKQRRVVRKA
FRKLAKLNRRRQQQTPSSCSSTSSSTASSCSSSPRTHESASVERMETLVHLVLSQDHTIR
QQVQRLHELDREIDHYEAKVHLDRMRRHGVNYVQDTYLVGAGIELDGSRPGEEPEEVAAE
AEEAAAAPPLAGEAQAAALEELARRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMR
RRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEAVKSDLDYSQQ
QWDSKKRELQGLLQTLHTLELTVAPDGAPGSGSPSREPGPQACADMWVDQARGLAKSGPG
NDEDSDTGLSSMHSQDSDSLPMCESLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NK89	1.000	1.000	1.133E-80	507	1.000	1.000	A6NK89.pdb.gz	RASFA_HUMAN Ras association domain-containing protein 10 OS=Homo sapiens OX=9606 GN=RASSF10 PE=1 SV=3
2	AFDB:Q8BL43	0.681	0.680	5.538E-64	508	0.866	0.864	Q8BL43.pdb.gz	RASFA_MOUSE Ras association domain-containing protein 10 OS=Mus musculus OX=10090 GN=Rassf10 PE=1 SV=2
3	AFDB:E1B705	0.186	0.216	3.196E-23	435	0.329	0.384	E1B705.pdb.gz	E1B705_BOVIN Ras association domain family member 9 OS=Bos taurus OX=9913 GN=RASSF9 PE=4 SV=3
4	AFDB:O88869	0.186	0.215	9.453E-22	435	0.321	0.375	O88869.pdb.gz	RASF9_RAT Ras association domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Rassf9 PE=1 SV=1
5	AFDB:F1R419	0.149	0.074	2.874E-7	1060	0.148	0.071	F1R419.pdb.gz	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
6	AFDB:Q8NHQ8	0.142	0.171	3.274E-7	419	0.170	0.205	Q8NHQ8.pdb.gz	RASF8_HUMAN Ras association domain-containing protein 8 OS=Homo sapiens OX=9606 GN=RASSF8 PE=1 SV=2
7	AFDB:F1QWN1	0.157	0.083	1.464E-6	1063	0.142	0.068	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
8	AFDB:D4A6A8	0.139	0.072	6.990E-6	1042	0.144	0.070	D4A6A8.pdb.gz	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
9	AFDB:Q96KQ4	0.149	0.075	1.177E-5	1090	0.154	0.072	Q96KQ4.pdb.gz	ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3
10	AFDB:Q13625	0.143	0.070	1.527E-5	1128	0.138	0.062	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
11	PDB:5itdA	0.152	0.081	3.526E-2	995	0.024	0.012	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
12	PDB:6pyuA	0.148	0.084	3.763E-2	930	0.032	0.017	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
13	PDB:6yvaC	0.121	0.357	3.763E-2	155	0.030	0.097	6yvaC.pdb.gz
14	PDB:5swpA	0.139	0.070	5.212E-2	1060	0.020	0.009	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
15	PDB:7vvbB	0.119	0.644	1.215E-1	77	0.032	0.208	7vvbB.pdb.gz	Structural insights into Ras regulation by SIN1.
16	PDB:5azhA	0.139	0.452	2.047E-1	127	0.034	0.134	5azhA.pdb.gz
17	PDB:3h9dA	0.133	0.470	2.184E-1	116	0.026	0.112	3h9dA.pdb.gz	Trypanosoma brucei ATG8: structural insights into autophagic-like mechanisms in protozoa.
18	PDB:4rm8A	0.125	0.169	2.184E-1	368	0.028	0.038	4rm8A.pdb.gz
19	PDB:6lanA	0.131	0.425	2.331E-1	133	0.026	0.098	6lanA.pdb.gz
20	PDB:2byvE	0.119	0.068	3.025E-1	922	0.026	0.014	2byvE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NK89	0.0	1017	507	1.000	1.000	RASFA_HUMAN Ras association domain-containing protein 10 OS=Homo sapiens OX=9606 GN=RASSF10 PE=1 SV=3
2	Q8BL43	0.0	753	508	0.866	0.864	RASFA_MOUSE Ras association domain-containing protein 10 OS=Mus musculus OX=10090 GN=Rassf10 PE=1 SV=2
3	E1B705	3.53e-77	250	435	0.337	0.393	E1B705_BOVIN Ras association domain family member 9 OS=Bos taurus OX=9913 GN=RASSF9 PE=4 SV=3
4	O75901	3.00e-73	240	435	0.339	0.395	RASF9_HUMAN Ras association domain-containing protein 9 OS=Homo sapiens OX=9606 GN=RASSF9 PE=2 SV=2
5	O88869	3.63e-72	237	435	0.339	0.395	RASF9_RAT Ras association domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Rassf9 PE=1 SV=1
6	Q9VUU9	8.72e-06	50.8	524	0.063	0.061	Q9VUU9_DROME Meru, isoform A OS=Drosophila melanogaster OX=7227 GN=meru PE=4 SV=2
7	Q9VBP2	0.003	42.7	607	0.057	0.048	Q9VBP2_DROME GH01133p OS=Drosophila melanogaster OX=7227 GN=RASSF8 PE=2 SV=1
8	F1QWN1	0.015	40.4	1063	0.032	0.015	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
9	Q1LXN7	0.015	40.4	1060	0.032	0.015	Q1LXN7_DANRE Tumor protein p53 binding protein, 2 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=1
10	F1R419	0.17	37.0	1060	0.030	0.014	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
11	Q6NSN9	0.17	37.0	1060	0.030	0.014	Q6NSN9_DANRE Apoptosis-stimulating of p53 protein 2 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
12	Q8IDX6	0.32	36.6	3130	0.063	0.010	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
13	A0A8I6B1X1	1.1	34.7	949	0.032	0.017	A0A8I6B1X1_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
14	M4IQQ5	1.7	33.9	556	0.036	0.032	CCL4_HUMLU 2-methylpropanoate--CoA ligase CCL4 OS=Humulus lupulus OX=3486 GN=CCL4 PE=1 SV=1
15	Q9EQ32	1.8	33.9	811	0.045	0.028	BCAP_MOUSE Phosphoinositide 3-kinase adapter protein 1 OS=Mus musculus OX=10090 GN=Pik3ap1 PE=1 SV=1
16	A0A5P8DHK4	1.9	33.9	8697	0.032	0.002	A0A5P8DHK4_RAT Nesprin 1 short isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
17	A0A5P8DHN0	1.9	33.9	8815	0.032	0.002	A0A5P8DHN0_RAT Nesprin 1 long isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
18	A0A8I5ZJB9	1.9	33.9	8815	0.032	0.002	A0A8I5ZJB9_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
19	A0A8I6ABC0	1.9	33.9	8788	0.032	0.002	A0A8I6ABC0_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
20	Q6ZWR6	3.2	33.1	8799	0.032	0.002	SYNE1_MOUSE Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05405 Mt_ATP-synt_B	3.1e+02	12.4	Mitochondrial ATP synthase B chain precursor (ATP-synt_B)
2	PF04926 PAP_RNA-bind	54	14.9	Poly(A) polymerase predicted RNA binding domain
3	PF00788 RA	22	17.1	Ras association (RalGDS/AF-6) domain
4	PF10500 SR-25	94	14.0	Nuclear RNA-splicing-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380713	0.879	Ras association domain-containing protein 7
2	9606.ENSP00000384491	0.855	Ras association domain family member 8
3	9606.ENSP00000340578	0.850	Ras association domain-containing protein 6
4	9606.ENSP00000349547	0.801	Ras association domain-containing protein 1
5	9606.ENSP00000462099	0.705	Ras association domain-containing protein 5
6	9606.ENSP00000368710	0.679	Ras association domain-containing protein 2
7	9606.ENSP00000443021	0.679	Ras association domain family member 3
8	9606.ENSP00000262662	0.654	Cyclin-dependent kinase 4 inhibitor C
9	9606.ENSP00000329803	0.603	Zygote arrest protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:2000177	0.988	regulation of neural precursor cell proliferation
GO:0048518	0.982	positive regulation of biological process
GO:0050767	0.956	regulation of neurogenesis
GO:0010720	0.956	positive regulation of cell development
GO:2000179	0.955	positive regulation of neural precursor cell proliferation
GO:0050769	0.954	positive regulation of neurogenesis
GO:0009987	0.807	cellular process
GO:0050896	0.657	response to stimulus
GO:0051716	0.606	cellular response to stimulus
GO:0019222	0.497	regulation of metabolic process
GO:0051171	0.479	regulation of nitrogen compound metabolic process
GO:0080090	0.457	regulation of primary metabolic process
GO:0023052	0.455	signaling
GO:0007154	0.454	cell communication
GO:0007165	0.396	signal transduction
GO:0060255	0.352	regulation of macromolecule metabolic process
GO:0048523	0.349	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0043229	0.993	intracellular organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0031982	0.975	vesicle
GO:0005829	0.974	cytosol
GO:0005634	0.834	nucleus
GO:0016020	0.749	membrane
GO:0012505	0.655	endomembrane system
GO:0097708	0.642	intracellular vesicle
GO:0005576	0.578	extracellular region
GO:0031090	0.496	organelle membrane
GO:0031410	0.476	cytoplasmic vesicle
GO:0043228	0.464	non-membrane-bounded organelle
GO:0043232	0.447	intracellular non-membrane-bounded organelle
GO:0070013	0.441	intracellular organelle lumen
GO:0032991	0.372	protein-containing complex
GO:0098588	0.368	bounding membrane of organelle
GO:0005856	0.350	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]