StarFunc result for job id A6NKB5

User Input

>input (2137 residues)
MVSQVLQLLRQGVWAALTGGWYHDPEQSKFTNSCHLYLWLFLLLLPLALHLAFPPNAIIV
FFYCSAVTIFFTIIKLVSYRLHLMFDKGEVIQQKPSRKEEKPNKDKEAKGEHITNHRNPS
NNRQIHNGKKEEASRNLSTPPLRCSSRGQSITSHHSSGPLELSAQETVEDLKGVILLEDH
PIAPVSSTSPGIKVESLPASQAHMLETTTKSVIPVKPVATETLINGKGKERGGKGQPPLR
HRSEGGLVDKGPLKKLPHLSLSQYDLLETDVSFQPWGSENSVLIPEPVSCPRGSIRERVQ
SKSPQDSLSSSCPQCDTIVAKPVEEPADTSCQVDTSCQGDLPLHQEVDSSDSEVAVTLID
TSQPGDPLSLHEPIKIVITMSSTPNSMTDLESSLHLRVVGTEKTSVKSDAEPTNPGAAGS
PNAEQISIPVITLDLPEGGGGGVPCPEGNGSERTPERLKTRVSTNQCSGYGSGEGGNAIK
DHSSSSREPWESVSRLTPDTGSESKVGKEGQTNLDPSSCKSSHEKRHARVLSVDSGTDVF
LSKSSAEIVNDTEKTMPTSKSDLEAKEGQMPNESNFLEFVSLLESINTSKMTASSQLNGS
AEQNEESGLLRDNCSQEKKEEILENEKPSGHSSKQGKPDLQSQDHTSTGPACTQPAKTTA
FFQGNRQRQIIYRVTSQQDSSVLQVISGPETSVQEEISVDAMHVFIDEHGEIRSCYLKSG
NQKEGPLQPLPSNNDCLSQAREMQVSSSSTTTSESQDPSSGDPAVSALQQQLLLMVARRT
QSETPRHVSQDLEASSCSSTQGKFNREQFYKFIIFPGKWIKVWYDRLTLLALLDRTEDIK
ENVLAILLIVLVSLLGFLTLSQGFCKDMWVLLFCLVMASCQYSLLKSVQPDPASPIHGHN
QIITYSRPIYFCVLCGLILLLDTGAKARHPPSYVVYGLKLFSPVFLQSARDYLIVFLYCF
PAISLLGLFPQINTFCTYLLEQIDMLFFGGSAVSGITSAVYSVARSVLAAALLHAVCFSA
VKEPWSMQHIPALFSAFCGLLVALSYHLSRQSSDPSVLMSFIQCRLFPKFLHQNLAESAA
DPLPKKMKDSVTDVLKWDLIVCAVVAVLSFAVSASTVFLSLRPFLSIVLFALAGAVGFVT
HYVLPQLRKHHPWMWISHPILKNKEYHQREVRDVAHLMWFERLYVWLQCFEKYILYPALI
LNALTIDAFLISNHRRLGTHWDIFLMIIAGMKLLRTSFCNPVYQFINLSFTVIFFHFDYK
DISESFLLDFFMVSILFSKLGDLLHKLQFVLTYVAPWQMAWGSSFHVFAQLFAIPHSAML
FFQTIATSIFSTPLSPFLGSVIFITSYVRPVKFWEKNYNTRRVDNSNTRLAVQIERDPGN
DDNNLNSIFYEHLTRTLQESLCGDLVLGRWGNYSSGDCFILASDDLNAFVHLIEIGNGLV
TFQLRGLEFRGTYCQQREVEAIMEGDEEDRGCCCCKPGHLPHLLSCNAAFHLRWLTWEIT
QTQYILEGYSILDNNAATMLQVFDLRRILIRYYIKSIIYYMVTSPKLLSWIKNESLLKSL
QPFAKWHYIERDLAMFNINIDDDYVPCLQGITRASFCNVYLEWIQHCARKRQEPSTTLDS
DEDSPLVTLSFALCTLGRRALGTAAHNMAISLDSFLYGLHVLFKGDFRITARDEWVFADM
DLLHKVVAPAIRMSLKLHQDQFTCPDEYEDPAVLYEAIQSFEKKVVICHEGDPAWRGAVL
SNKEELLTLRHVVDEGADEYKVIMLHRSFLSFKVIKVNKECVRGLWAGQQQELIFLRNRN
PERGSIQNNKQVLRNLINSSCDQPLGYPMYVSPLTTSYLGTHRQLKNIWGGPITLDRIRT
WFWTKWVRMRKDCNARQHSGGNIEDVDGGGAPTTGGNNAPSGGSQESSAEQPRKGGAQHG
VSSCEGTQRTGRRKGRSQSVQAHSALSQRPPMLSSSGPILESRQTFLQTSTSVHELAQRL
SGSRLSLHASATSLHSQPPPVTTTGHLSVRERAEALIRSSLGSSTSSTLSFLFGKRSFSS
ALVISGLSAAEGGNTSDTQSSSSVNIVMGPSARAASQATRHLSEPCEPPDATEQGQLHDR
CLAEAVADTLGVVCRRASQEDMGLDDTASQQSVSDEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NKB5	1.000	1.000	0.000	2137	1.000	1.000	A6NKB5.pdb.gz	PCX2_HUMAN Pecanex-like protein 2 OS=Homo sapiens OX=9606 GN=PCNX2 PE=1 SV=3
2	AFDB:Q4GYI9	0.050	0.058	3.162E-4	1737	0.116	0.142	Q4GYI9.pdb.gz	Q4GYI9_TRYB2 Fusaric acid resistance protein-like OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3880 PE=4 SV=1
3	PDB:4iggB	0.051	0.103	7.388E-1	771	0.046	0.127	4iggB.pdb.gz
4	PDB:7nyhM	0.055	0.113	9.095E-1	504	0.029	0.123	7nyhM.pdb.gz
5	PDB:7wuhE	0.026	0.044	1.167	1044	0.012	0.024	7wuhE.pdb.gz	Vaccination with SARS-CoV-2 spike protein lacking glycan shields elicits enhanced protective responses in animal models.
6	AFDB:E5FYH1	0.048	0.055	1.237	1653	0.092	0.119	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
7	PDB:7wnxA	0.045	0.097	1.697	734	0.027	0.078	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
8	PDB:7t3pA	0.050	0.050	1.844	2066	0.066	0.068	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
9	PDB:7pw9A	0.040	0.042	2.088	1952	0.054	0.059	7pw9A.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
10	PDB:7lqvB	0.024	0.038	2.269	1112	0.011	0.021	7lqvB.pdb.gz
11	AFDB:D3ZUI5	0.028	0.045	2.507	1133	0.057	0.107	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
12	AFDB:Q5H9R4	0.041	0.040	2.613	2290	0.068	0.063	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
13	PDB:6cc4A	0.037	0.085	2.680	608	0.030	0.105	6cc4A.pdb.gz
14	PDB:7r5jB0	0.058	0.064	2.680	1748	0.054	0.066	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:5lzqA	0.045	0.084	2.912	725	0.025	0.073	5lzqA.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
16	AFDB:Q14050	0.019	0.042	3.086	684	0.050	0.156	Q14050.pdb.gz	CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens OX=9606 GN=COL9A3 PE=1 SV=2
17	AFDB:Q8SXD4	0.020	0.031	3.496	1122	0.059	0.112	Q8SXD4.pdb.gz	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1
18	AFDB:Q9SE97	0.034	0.058	3.496	1051	0.070	0.143	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
19	AFDB:H2KYA5	0.024	0.028	3.799	1793	0.057	0.068	H2KYA5.pdb.gz	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
20	AFDB:Q6ZPE7	0.022	0.040	3.799	858	0.055	0.138	Q6ZPE7.pdb.gz	Q6ZPE7_MOUSE MKIAA3015 protein (Fragment) OS=Mus musculus OX=10090 GN=Nav2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NKB5	0.0	4426	2137	1.000	1.000	PCX2_HUMAN Pecanex-like protein 2 OS=Homo sapiens OX=9606 GN=PCNX2 PE=1 SV=3
2	P18490	0.0	663	3413	0.134	0.084	PCX_DROME Protein pecanex OS=Drosophila melanogaster OX=7227 GN=pcx PE=2 SV=4
3	Q63HM2	2.77e-13	78.2	1172	0.024	0.044	PCX4_HUMAN Pecanex-like protein 4 OS=Homo sapiens OX=9606 GN=PCNX4 PE=1 SV=4
4	P05121	0.28	38.5	402	0.016	0.085	PAI1_HUMAN Plasminogen activator inhibitor 1 OS=Homo sapiens OX=9606 GN=SERPINE1 PE=1 SV=1
5	Q387Y7	5.5	34.7	1214	0.014	0.024	Q387Y7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1270 PE=4 SV=1
6	Q9VWD9	6.2	34.3	547	0.017	0.066	Q9VWD9_DROME LD38919p OS=Drosophila melanogaster OX=7227 GN=Ubqn PE=1 SV=1
7	Q6FSR7	6.3	34.3	889	0.014	0.034	VPS34_CANGA Phosphatidylinositol 3-kinase VPS34 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=VPS34 PE=1 SV=1
8	B7Z0W9	7.1	34.3	1576	0.017	0.023	OTOP_DROME Proton channel OtopLc OS=Drosophila melanogaster OX=7227 GN=OtopLc PE=3 SV=2
9	Q4LDP4	8.1	34.3	1931	0.012	0.013	Q4LDP4_DROME Testis-specific gamma-tubulin ring protein 91 OS=Drosophila melanogaster OX=7227 GN=t-Grip91 PE=4 SV=1
10	P18956	8.6	33.9	580	0.012	0.043	GGT_ECOLI Glutathione hydrolase proenzyme OS=Escherichia coli (strain K12) OX=83333 GN=ggt PE=1 SV=1
11	Q387Y1	8.7	33.9	1154	0.014	0.026	Q387Y1_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1180 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05041 Pecanex_C	5.9e-111	381.0	Pecanex protein (C-terminus)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430620	0.689	Hephaestin
2	9606.ENSP00000422533	0.623	Adhesion G protein-coupled receptor L3
3	9606.ENSP00000265372	0.592	cAMP responsive element modulator
4	9606.ENSP00000261486	0.544	Erythrocyte membrane protein band 4.1 like 4A
5	9606.ENSP00000389455	0.529	Disrupted in renal carcinoma 3
6	9606.ENSP00000483469	0.529	Probable G-protein coupled receptor 179
7	9606.ENSP00000367459	0.519	Dyslexia-associated protein KIAA0319
8	9606.ENSP00000263663	0.505	TATA box-binding protein-associated factor RNA polymerase I subunit B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0071704	0.509	organic substance metabolic process
GO:0044238	0.495	primary metabolic process
GO:0050789	0.489	regulation of biological process
GO:0044237	0.398	cellular metabolic process
GO:0050794	0.307	regulation of cellular process
GO:0016043	0.300	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0016020	0.984	membrane
GO:0005783	0.969	endoplasmic reticulum
GO:0071944	0.613	cell periphery
GO:0005886	0.461	plasma membrane
GO:0032991	0.314	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]