StarFunc result for job id A6NKC0

User Input

>input (464 residues)
MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRSPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRAEANPGPLNKDKGEKEERPRQQDPQRNALLHM
FSGKPPEKPLPNGKGSTESSEHLRVASGPMPVHTTSKRPRVDPVLADRSATEMSGRGSVL
ASLSPLRKASLSSSSSLGPKERQTGAAADIPQPAFRHQGPEPLLVVKPTHSSPEGGCREV
PQAASKTHGLLQAVRPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELRAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVD
RQPPHSTPCLPTAQACTMSHHPAAGHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.261	0.261	1.298E-57	464	0.922	0.922	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:O94358	0.070	0.048	2.837E-1	845	0.144	0.079	O94358.pdb.gz	YHOA_SCHPO Uncharacterized protein C428.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC428.10 PE=1 SV=2
3	AFDB:F1QXI5	0.071	0.040	5.588E-1	1003	0.149	0.069	F1QXI5.pdb.gz
4	AFDB:Q4WEP7	0.053	0.035	5.588E-1	888	0.125	0.065	Q4WEP7.pdb.gz	CHIA1_ASPFU Endochitinase A1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=chiA1 PE=3 SV=1
5	AFDB:Q8N1G0	0.060	0.030	5.588E-1	1237	0.157	0.059	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
6	AFDB:Q90ZE2	0.071	0.062	5.588E-1	589	0.203	0.160	Q90ZE2.pdb.gz	ZN703_DANRE Zinc finger protein 703 OS=Danio rerio OX=7955 GN=znf703 PE=1 SV=1
7	AFDB:P0CL69	0.075	0.063	7.328E-1	594	0.175	0.136	P0CL69.pdb.gz	ZN703_MOUSE Zinc finger protein 703 OS=Mus musculus OX=10090 GN=Znf703 PE=1 SV=1
8	AFDB:M9PGE2	0.062	0.028	8.981E-1	1257	0.155	0.057	M9PGE2.pdb.gz	M9PGE2_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
9	AFDB:Q9NPG3	0.069	0.036	8.981E-1	1134	0.181	0.074	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
10	AFDB:Q385F2	0.086	0.039	1.028	1231	0.162	0.061	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
11	PDB:7c4cA	0.038	0.053	1.580	332	0.019	0.027	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
12	PDB:5hutA	0.040	0.040	1.809	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
13	PDB:3sucA	0.045	0.029	2.072	767	0.011	0.007	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
14	PDB:2k8pA	0.044	0.089	2.217	189	0.056	0.138	2k8pA.pdb.gz
15	PDB:3zqjF	0.046	0.036	2.717	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
16	PDB:7mq8L8	0.039	0.097	2.717	180	0.013	0.033	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6i9ra	0.057	0.242	2.908	83	0.013	0.072	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
18	PDB:7y9tA	0.052	0.063	3.112	380	0.015	0.018	7y9tA.pdb.gz
19	PDB:6edtJ	0.060	0.165	3.330	109	0.028	0.119	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
20	PDB:6exnc	0.028	0.064	3.813	204	0.022	0.049	6exnc.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	807	464	0.922	0.922	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P03348	0.42	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
6	P04590	0.44	35.4	522	0.078	0.069	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
7	P04585	0.50	35.4	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
8	P03366	0.55	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
9	Q7TMB7	0.86	34.7	766	0.034	0.021	PLPR4_RAT Phospholipid phosphatase-related protein type 4 OS=Rattus norvegicus OX=10116 GN=Plppr4 PE=1 SV=1
10	P05888	0.93	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
11	Q72497	1.1	34.3	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	Q79791	1.1	34.3	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
13	G5EF97	3.3	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
14	P12497	5.6	32.0	1435	0.030	0.010	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
15	P35963	5.7	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
16	A0A8I6A7M0	9.3	31.6	1893	0.024	0.006	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
17	Q80UV9	9.4	31.6	1891	0.024	0.006	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2
18	A0A8I6A7N8	9.6	31.6	1837	0.024	0.006	A0A8I6A7N8_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
19	Q60544	9.7	31.2	1865	0.024	0.006	TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus OX=10036 GN=TAF1 PE=2 SV=1
20	Q8IZX4	9.9	31.2	1826	0.024	0.006	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	1.1e+02	14.4	Zinc knuckle
2	PF15288 zf-CCHC_6	8.8e-20	81.6	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.442	catalytic activity
GO:0016740	0.356	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0044238	0.992	primary metabolic process
GO:0050794	0.955	regulation of cellular process
GO:0006807	0.923	nitrogen compound metabolic process
GO:0019222	0.866	regulation of metabolic process
GO:0043170	0.862	macromolecule metabolic process
GO:0031323	0.859	regulation of cellular metabolic process
GO:0019219	0.837	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.831	regulation of macromolecule metabolic process
GO:0048518	0.822	positive regulation of biological process
GO:0048522	0.806	positive regulation of cellular process
GO:0009893	0.789	positive regulation of metabolic process
GO:0031325	0.742	positive regulation of cellular metabolic process
GO:0051252	0.733	regulation of RNA metabolic process
GO:0010468	0.694	regulation of gene expression
GO:0031326	0.691	regulation of cellular biosynthetic process
GO:0010556	0.690	regulation of macromolecule biosynthetic process
GO:0010604	0.672	positive regulation of macromolecule metabolic process
GO:0051173	0.668	positive regulation of nitrogen compound metabolic process
GO:0044260	0.664	cellular macromolecule metabolic process
GO:0006355	0.658	regulation of DNA-templated transcription
GO:0045935	0.646	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.559	positive regulation of RNA biosynthetic process
GO:1901564	0.473	organonitrogen compound metabolic process
GO:0006139	0.446	nucleobase-containing compound metabolic process
GO:0045893	0.445	positive regulation of DNA-templated transcription
GO:0090304	0.381	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0031981	0.976	nuclear lumen
GO:0005654	0.970	nucleoplasm
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0005694	0.889	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.356	Transferases.

[back to server]