StarFunc result for job id A6NKF1

User Input

>input (404 residues)
MAGRRAQTGSAPPRPAAPHPRPASRAFPQHCRPRDAERPPSPRSPLMPGCELPVGTCPDM
CPAAERAQREREHRLHRLEVVPGCRQDPPRADPQRAVKEYSRPAAGKPRPPPSQLRPPSV
LLATVRYLAGEVAESADIARAEVASFVADRLRAVLLDLALQGAGDAEAAVVLEAALATLL
TVVARLGPDAARGPADPVLLQAQVQEGFGSLRRCYARGAGPHPRQPAFQGLFLLYNLGSV
EALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRLLQTLPYLPSCAVQCHVGHAR
REALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRY
VEEGLPPASTCKVLVESKLRGRTLEEVVMAEEEDEGTDRPGSPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NKF1	1.000	1.000	2.297E-61	404	1.000	1.000	A6NKF1.pdb.gz	SAC31_HUMAN SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2
2	AFDB:A6H687	0.871	0.825	4.615E-45	427	0.718	0.679	A6H687.pdb.gz	SAC31_MOUSE SAC3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sac3d1 PE=1 SV=1
3	AFDB:Q9WUU9	0.778	0.167	8.056E-20	1971	0.260	0.053	Q9WUU9.pdb.gz	GANP_MOUSE Germinal-center associated nuclear protein OS=Mus musculus OX=10090 GN=Mcm3ap PE=1 SV=2
4	AFDB:Q9U3V9	0.769	0.236	1.794E-19	1370	0.282	0.083	Q9U3V9.pdb.gz	XMAS_DROME Protein xmas OS=Drosophila melanogaster OX=7227 GN=xmas PE=1 SV=4
5	AFDB:O60318	0.768	0.164	3.812E-19	1980	0.243	0.049	O60318.pdb.gz	GANP_HUMAN Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2
6	AFDB:O74889	0.755	0.311	1.244E-17	1024	0.238	0.094	O74889.pdb.gz	SAC31_SCHPO SAC3 family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC576.05 PE=1 SV=1
7	AFDB:F4JAU2	0.731	0.188	2.307E-16	1697	0.248	0.059	F4JAU2.pdb.gz	SAC3B_ARATH SAC3 family protein B OS=Arabidopsis thaliana OX=3702 GN=SAC3B PE=1 SV=1
8	AFDB:P46674	0.724	0.239	2.111E-15	1301	0.210	0.065	P46674.pdb.gz	SAC3_YEAST Nuclear mRNA export protein SAC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAC3 PE=1 SV=2
9	AFDB:Q9USI4	0.722	0.644	1.150E-14	458	0.220	0.194	Q9USI4.pdb.gz	SAC32_SCHPO SAC3 family protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC70.06 PE=3 SV=1
10	PDB:5l3tA	0.587	0.788	6.300E-10	294	0.141	0.194	5l3tA.pdb.gz	The Sac3 TPR-like region in the Saccharomyces cerevisiae TREX-2 complex is more extensive but independent of the CID region.
11	AFDB:Q96PV6	0.497	0.263	1.983E-9	800	0.198	0.100	Q96PV6.pdb.gz	LENG8_HUMAN Leukocyte receptor cluster member 8 OS=Homo sapiens OX=9606 GN=LENG8 PE=1 SV=3
12	PDB:4cr2T	0.364	0.519	1.092E-3	272	0.072	0.107	4cr2T.pdb.gz	Deep Classification of a Large Cryo-Em Dataset Defines the Conformational Landscape of the 26S Proteasome.
13	PDB:3jckD	0.204	0.212	5.952E-3	384	0.106	0.112	3jckD.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
14	PDB:6zonK	0.282	0.449	7.186E-3	217	0.064	0.120	6zonK.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
15	PDB:6fvtR	0.195	0.196	2.952E-2	405	0.106	0.106	6fvtR.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
16	PDB:3jckF	0.200	0.205	3.400E-2	388	0.094	0.098	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
17	PDB:5l4kQ	0.240	0.233	3.736E-2	422	0.106	0.102	5l4kQ.pdb.gz
18	PDB:6r7fC	0.216	0.217	5.446E-2	403	0.094	0.094	6r7fC.pdb.gz
19	PDB:5mpbQ	0.297	0.280	6.272E-2	434	0.072	0.067	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
20	PDB:4d10H	0.192	0.382	8.321E-2	173	0.069	0.162	4d10H.pdb.gz	Crystal Structure of the Human Cop9 Signalosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NKF1	0.0	783	404	1.000	1.000	SAC31_HUMAN SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2
2	A6H687	7.63e-161	461	427	0.708	0.670	SAC31_MOUSE SAC3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sac3d1 PE=1 SV=1
3	Q9WUU9	2.81e-35	140	1971	0.235	0.048	GANP_MOUSE Germinal-center associated nuclear protein OS=Mus musculus OX=10090 GN=Mcm3ap PE=1 SV=2
4	O60318	2.10e-34	138	1980	0.235	0.048	GANP_HUMAN Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2
5	Q9U3V9	3.62e-32	131	2079	0.262	0.051	XMAS_DROME Protein xmas OS=Drosophila melanogaster OX=7227 GN=xmas PE=1 SV=4
6	O74889	2.26e-27	117	1024	0.240	0.095	SAC31_SCHPO SAC3 family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC576.05 PE=1 SV=1
7	Q9USI4	2.44e-17	85.9	458	0.235	0.207	SAC32_SCHPO SAC3 family protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC70.06 PE=3 SV=1
8	F4JAU2	5.14e-15	79.7	1697	0.240	0.057	SAC3B_ARATH SAC3 family protein B OS=Arabidopsis thaliana OX=3702 GN=SAC3B PE=1 SV=1
9	P46674	1.16e-09	62.8	1301	0.208	0.065	SAC3_YEAST Nuclear mRNA export protein SAC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAC3 PE=1 SV=2
10	F4IUY8	3.39e-07	55.1	1006	0.129	0.052	SAC3A_ARATH SAC3 family protein A OS=Arabidopsis thaliana OX=3702 GN=SAC3A PE=1 SV=1
11	Q96PV6	7.28e-06	50.4	800	0.146	0.074	LENG8_HUMAN Leukocyte receptor cluster member 8 OS=Homo sapiens OX=9606 GN=LENG8 PE=1 SV=3
12	Q5AMT3	0.18	36.2	371	0.050	0.054	Q5AMT3_CANAL Methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C402260CA PE=3 SV=1
13	E0CXK2	0.28	36.2	1835	0.057	0.013	E0CXK2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
14	Q9Y6V0	0.30	36.2	5142	0.077	0.006	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
15	Q5B823	0.67	35.0	2444	0.084	0.014	Q5B823_EMENI alpha-1,3-glucan synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03307 PE=3 SV=1
16	A8DYH1	1.3	33.9	1739	0.040	0.009	A8DYH1_DROME Muscle wasted, isoform C OS=Drosophila melanogaster OX=7227 GN=mute PE=4 SV=1
17	Q54S20	1.3	33.9	2678	0.032	0.005	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1
18	A2ASS6	4.9	32.3	35213	0.079	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
19	Q9NV31	5.8	30.8	184	0.111	0.245	IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens OX=9606 GN=IMP3 PE=1 SV=1
20	Q9QYX7	5.8	32.0	5068	0.069	0.006	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03399 SAC3_GANP	3.1e-65	232.0	SAC3/GANP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479494	0.881	PCI domain containing 2
2	9606.ENSP00000428259	0.773	Centrin-3
3	9606.ENSP00000362480	0.744	Vacuolar protein sorting-associated protein 26A
4	9606.ENSP00000319052	0.743	Centrin-1
5	9606.ENSP00000359300	0.743	Centrin-2
6	9606.ENSP00000253047	0.734	Transmembrane protein 160
7	9606.ENSP00000245838	0.714	THO complex subunit 2
8	9606.ENSP00000282007	0.714	Zinc finger CCCH domain-containing protein 13
9	9606.ENSP00000299138	0.703	Vacuolar protein sorting-associated protein 35
10	9606.ENSP00000401303	0.702	SHC-transforming protein 1
11	9606.ENSP00000360329	0.687	Tetratricopeptide repeat domain containing
12	9606.ENSP00000293328	0.681	Signal transducer and activator of transcription 5B
13	9606.ENSP00000480853	0.681	Vacuolar protein sorting-associated protein 29
14	9606.ENSP00000379601	0.662	Ras-related protein Rab-27A
15	9606.ENSP00000444029	0.658	Nuclear pore complex protein Nup153
16	9606.ENSP00000347464	0.620	ARF GTPase-activating protein GIT2
17	9606.ENSP00000264605	0.606	Melanophilin
18	9606.ENSP00000298585	0.592	Zinc finger MYND domain-containing protein 19
19	9606.ENSP00000378504	0.583	Nuclear RNA export factor 3
20	9606.ENSP00000426978	0.583	Nuclear RNA export factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.987	biological regulation
GO:0007017	0.983	microtubule-based process
GO:0044085	0.977	cellular component biogenesis
GO:0007010	0.976	cytoskeleton organization
GO:0050794	0.975	regulation of cellular process
GO:0022402	0.975	cell cycle process
GO:0048519	0.970	negative regulation of biological process
GO:0009966	0.969	regulation of signal transduction
GO:0000226	0.955	microtubule cytoskeleton organization
GO:0022607	0.953	cellular component assembly
GO:0048523	0.947	negative regulation of cellular process
GO:0031023	0.940	microtubule organizing center organization
GO:0048585	0.938	negative regulation of response to stimulus
GO:0023057	0.938	negative regulation of signaling
GO:0007098	0.931	centrosome cycle
GO:1904892	0.925	regulation of receptor signaling pathway via STAT
GO:0009968	0.920	negative regulation of signal transduction
GO:0070925	0.908	organelle assembly
GO:0007051	0.884	spindle organization
GO:0051298	0.878	centrosome duplication
GO:0007059	0.845	chromosome segregation
GO:0046425	0.783	regulation of receptor signaling pathway via JAK-STAT
GO:0140694	0.725	non-membrane-bounded organelle assembly
GO:0051225	0.658	spindle assembly
GO:0002682	0.367	regulation of immune system process
GO:0050776	0.358	regulation of immune response
GO:1904893	0.325	negative regulation of receptor signaling pathway via STAT
GO:0046426	0.319	negative regulation of receptor signaling pathway via JAK-STAT

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0070013	0.986	intracellular organelle lumen
GO:0031981	0.957	nuclear lumen
GO:0005856	0.955	cytoskeleton
GO:0015630	0.933	microtubule cytoskeleton
GO:0005737	0.919	cytoplasm
GO:0005815	0.899	microtubule organizing center
GO:0005813	0.894	centrosome
GO:0005829	0.871	cytosol
GO:0005819	0.844	spindle
GO:0005654	0.734	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]