StarFunc result for job id A6NKF2

User Input

>input (412 residues)
MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDE
EKREEAGAEEEAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFL
DDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPT
TITSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTATPLFGLAGP
PPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLAL
PVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLA
GSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NKF2	0.999	0.999	1.867E-61	412	1.000	1.000	A6NKF2.pdb.gz	ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ARID3C PE=1 SV=1
2	AFDB:A6PWV5	0.608	0.612	6.292E-47	409	0.854	0.861	A6PWV5.pdb.gz	ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=2
3	AFDB:Q62431	0.356	0.248	4.034E-23	601	0.461	0.316	Q62431.pdb.gz	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1
4	AFDB:Q9Z1N7	0.326	0.242	1.649E-20	568	0.427	0.310	Q9Z1N7.pdb.gz	ARI3B_MOUSE AT-rich interactive domain-containing protein 3B OS=Mus musculus OX=10090 GN=Arid3b PE=1 SV=1
5	AFDB:O02326	0.331	0.294	1.660E-18	467	0.328	0.289	O02326.pdb.gz	CFI1_CAEEL AT-rich interactive domain-containing protein cfi-1 OS=Caenorhabditis elegans OX=6239 GN=cfi-1 PE=1 SV=3
6	AFDB:F1LNP1	0.248	0.061	1.528E-8	1751	0.240	0.057	F1LNP1.pdb.gz	F1LNP1_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=3
7	AFDB:H0Y2R3	0.236	0.137	3.285E-6	727	0.187	0.106	H0Y2R3.pdb.gz	H0Y2R3_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2
8	AFDB:A2CG63	0.223	0.073	3.201E-5	1314	0.153	0.048	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
9	AFDB:A0A669KBH0	0.216	0.271	1.091E-4	327	0.153	0.193	A0A669KBH0.pdb.gz	A0A669KBH0_HUMAN AT-rich interaction domain 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=1
10	AFDB:A0A0K3AXH1	0.218	0.059	6.664E-4	1648	0.133	0.033	A0A0K3AXH1.pdb.gz	ARID1_CAEEL AT-rich interactive domain-containing protein arid-1 OS=Caenorhabditis elegans OX=6239 GN=arid-1 PE=3 SV=1
11	PDB:5xtcd	0.073	0.119	9.620E-1	171	0.058	0.140	5xtcd.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
12	PDB:5xjt2	0.094	0.150	1.146	217	0.053	0.101	5xjt2.pdb.gz	Structures of 7S mutant complexes
13	PDB:7ksrC	0.078	0.079	1.215	397	0.056	0.058	7ksrC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
14	PDB:7z37DP1	0.085	0.115	1.627	273	0.044	0.066	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
15	PDB:7mr1C	0.084	0.040	2.448	1101	0.036	0.014	7mr1C.pdb.gz
16	PDB:1cnt1	0.078	0.157	2.595	150	0.051	0.140	1cnt1.pdb.gz
17	PDB:5tthB	0.086	0.065	2.751	621	0.044	0.029	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
18	PDB:7ajtUO	0.111	0.098	2.751	493	0.058	0.049	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7ksoC	0.100	0.099	2.751	420	0.046	0.045	7ksoC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
20	PDB:1oqyA	0.085	0.093	2.917	363	0.075	0.085	1oqyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NKF2	0.0	816	412	1.000	1.000	ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ARID3C PE=1 SV=1
2	A6PWV5	0.0	597	409	0.799	0.804	ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=2
3	B7ZP08	0.0	521	379	0.728	0.792	B7ZP08_MOUSE AT-rich interactive domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=1
4	Q99856	5.54e-93	293	593	0.439	0.305	ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2
5	Q62431	2.71e-85	273	601	0.466	0.319	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1
6	Q8IVW6	2.13e-79	257	561	0.364	0.267	ARI3B_HUMAN AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B PE=1 SV=2
7	Q9Z1N7	2.13e-78	254	568	0.376	0.273	ARI3B_MOUSE AT-rich interactive domain-containing protein 3B OS=Mus musculus OX=10090 GN=Arid3b PE=1 SV=1
8	Q24573	6.78e-68	233	911	0.245	0.111	DRI_DROME Protein dead ringer OS=Drosophila melanogaster OX=7227 GN=retn PE=1 SV=2
9	O02326	2.42e-62	209	467	0.243	0.214	CFI1_CAEEL AT-rich interactive domain-containing protein cfi-1 OS=Caenorhabditis elegans OX=6239 GN=cfi-1 PE=1 SV=3
10	Q8IN94	2.89e-20	95.9	2716	0.102	0.015	OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster OX=7227 GN=osa PE=1 SV=1
11	H0Y2R3	4.57e-19	91.7	727	0.109	0.062	H0Y2R3_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2
12	E9Q4N7	7.80e-19	91.7	2306	0.114	0.020	ARI1B_MOUSE AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=2
13	A0A1B0GV63	2.70e-18	89.7	1349	0.158	0.048	A0A1B0GV63_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
14	A0A0G2JVD3	4.17e-18	89.4	2375	0.100	0.017	A0A0G2JVD3_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=1
15	Q8NFD5	6.12e-18	89.0	2319	0.100	0.018	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
16	A0A3F2YNW7	6.41e-18	89.0	2332	0.100	0.018	A0A3F2YNW7_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
17	A0A1B0GWZ0	6.65e-18	88.6	1864	0.100	0.022	A0A1B0GWZ0_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=2
18	F1LNP1	7.07e-18	88.6	1763	0.100	0.023	F1LNP1_RAT AT-rich interaction domain 1B OS=Rattus norvegicus OX=10116 GN=Arid1b PE=1 SV=3
19	H0Y7H8	9.27e-18	88.2	1758	0.100	0.023	H0Y7H8_HUMAN AT-rich interaction domain 1B (Fragment) OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1
20	A0A1B0GVK1	1.49e-17	87.4	1539	0.100	0.027	A0A1B0GVK1_HUMAN AT-rich interaction domain 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	5.7e-16	70.3	ARID/BRIGHT DNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368189

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392452	0.595	Protein FAM219A
2	9606.ENSP00000263121	0.573	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
3	9606.ENSP00000417711	0.561	Protein FAM205A
4	9606.ENSP00000265773	0.539	Probable global transcription activator SNF2L2
5	9606.ENSP00000259632	0.529	Dynactin subunit 3
6	9606.ENSP00000395654	0.517	Transcription activator BRG1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.863	heterocyclic compound binding
GO:0097159	0.863	organic cyclic compound binding
GO:0003676	0.826	nucleic acid binding
GO:0003677	0.721	DNA binding
GO:0140110	0.420	transcription regulator activity
GO:0043565	0.388	sequence-specific DNA binding
GO:0000976	0.363	transcription cis-regulatory region binding
GO:0003682	0.316	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0006357	0.983	regulation of transcription by RNA polymerase II
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0048522	0.976	positive regulation of cellular process
GO:0045893	0.969	positive regulation of DNA-templated transcription
GO:0045944	0.942	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.995	nucleus
GO:0005737	0.966	cytoplasm
GO:0005654	0.965	nucleoplasm
GO:0016020	0.958	membrane
GO:0032991	0.746	protein-containing complex
GO:0043232	0.729	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]