StarFunc result for job id A6NKG5

User Input

>input (1358 residues)
MIEPSEDSFETMMEHKNPSSKQMESSEGSSNTTEATSGSGVRGEAGPASGPAQEKKEPPS
GPLQEMEELPTDLLQDMEEPSSGPRKEIEDPPNDLLQDLEESCNGSHQARGDPLSGASDR
MKEASVNPSGAREEQEAHTDLKESGREETPQEQNQTEHSTAELMAMVRSIISLYFRMQDL
KEQQRVAEEILIKGINAGQLPAPKHFSGDRREFHEFIVLCQLTLQSYPRMFYNDRLRVGY
VINHLSGLALEWAKALLQENSPLIGDFPAFLEAMSEVFEYRQALRVAEEAMFTIRQGGRS
ATEYIDEFQSLVPILGWPDEVLQAHLCQGLNEEIRHYLFRVPQPDSLDSLIVLILQIEEK
LAERRAMLRLPPEARPRNLTWIDSPAPERWMVSSWLPSEVHPDINRAHLFLLLMVRVNPY
HSVAVQALVDSGADGNFMDEKFAQEHYVELYEKPYPQPVQSVDGSLIGNEPVWLYTEPLV
CIHQNHQESIEFDIVPSPNFSVVLGIRWLRVHAPEVDWIKGRCTFHSPYCLKNCFRPPPP
CIALERHGMSLLPGLPHPYSDLADVFNPKEADDETSDQPSSDGSDDLSESEPSELQQAGD
SDHSETFYECPSTAPWEPVGARMQERARLQEEYWDLQDMLTNRQDYIQMIPELFDQLHGA
EWFTKLELRGTIVEESVNGHRTEDVWKAAFGLELEEMKSYQPFALSPDPIIPQNVIHFIL
KDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGF
VVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSS
YQFYWGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKR
ACCAFYSRNISPIEVEYSQAEMKILPIRAAFMVWCRYLENTEEPIMILLNTEDLASLNND
RLTVLLPGHWVFFFSHFNFDVMELPEQDGGRALPPVRNLRWRRAFQRNTAARQTLLLASR
GFPRDPSTESGEEENEEQDELNEQILRQELLAMIPIDQILNSFLAHFSMAQIRAVILHFF
RGLLYWKNTLALAAILVLLRVRQCLSLRPAPAMRVARPQPQRSLRLILDSSLIAGSSITT
AITQLLTQMPALVGANTIPAQELAELFLGPGRWQRNALHSQAHRGLQFTPGFWLTLCEFF
GVRVTPQEGHLPALRQNRYLELHVVGDEDVVLREALQDDLQRYRQCGLHDGLQDTSQDKQ
DNDVQEAPPSHTAATHPPRPRHLMDPQVLEFLGSRLLHIHSADGQLHLLSREQAARALSQ
FLTLIYRRALPIPAWESQPREQARLEELPDEDEDANLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CT40	0.236	0.240	1.944E-36	1333	0.125	0.128	P0CT40.pdb.gz	TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1
2	AFDB:Q7TN75	0.093	0.132	4.197E-28	958	0.120	0.170	Q7TN75.pdb.gz	PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus OX=10090 GN=Peg10 PE=1 SV=2
3	PDB:2jleA	0.171	0.381	3.297E-6	545	0.025	0.062	2jleA.pdb.gz	Novel Indazole Non-Nucleoside Reverse Transcriptase Inhibitors Using Molecular Hybridization Based on Crystallographic Overlays.
4	AFDB:Q54WI0	0.059	0.060	1.649E-4	1333	0.107	0.109	Q54WI0.pdb.gz	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
5	AFDB:O61528	0.042	0.028	6.125E-3	2488	0.059	0.032	O61528.pdb.gz	O61528_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
6	PDB:4dchA	0.062	0.171	1.317E-2	434	0.014	0.044	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
7	PDB:1qhaA	0.062	0.090	1.718E-2	903	0.016	0.024	1qhaA.pdb.gz	Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.
8	PDB:6p7bA	0.058	0.361	1.718E-2	149	0.011	0.101	6p7bA.pdb.gz	Structural insights into the promiscuous DNA binding and broad substrate selectivity of fowlpox virus resolvase.
9	PDB:1ig8A	0.047	0.126	2.923E-2	469	0.010	0.028	1ig8A.pdb.gz
10	PDB:7p2eI	0.061	0.352	3.616E-2	137	0.013	0.131	7p2eI.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
11	PDB:3idhA	0.050	0.138	4.472E-2	453	0.013	0.038	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
12	PDB:1dt9A	0.045	0.120	6.843E-2	398	0.021	0.073	1dt9A.pdb.gz
13	PDB:2yhxA	0.051	0.137	6.843E-2	457	0.010	0.028	2yhxA.pdb.gz	Sequencing a protein by x-ray crystallography. II. Refinement of yeast hexokinase B co-ordinates and sequence at 2.1 A resolution.
14	AFDB:A0A024R0R1	0.052	0.067	7.064E-2	912	0.068	0.101	A0A024R0R1.pdb.gz
15	PDB:3b8aX	0.048	0.128	8.026E-2	470	0.013	0.036	3b8aX.pdb.gz	Crystal structure of yeast hexokinase PI in complex with glucose: A classical "induced fit" example revised.
16	AFDB:Q3UHU5	0.043	0.034	9.718E-2	1945	0.167	0.117	Q3UHU5.pdb.gz	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
17	AFDB:Q14004	0.058	0.057	1.140E-1	1512	0.129	0.116	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
18	AFDB:P52172	0.038	0.041	1.839E-1	1264	0.119	0.127	P52172.pdb.gz	SRP_DROME Box A-binding factor OS=Drosophila melanogaster OX=7227 GN=srp PE=1 SV=2
19	AFDB:Q52KB6	0.046	0.034	2.045E-1	2323	0.088	0.051	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
20	AFDB:Q582C1	0.056	0.062	2.157E-1	1177	0.113	0.130	Q582C1.pdb.gz	Q582C1_TRYB2 WW domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.560 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7M732	0.0	1319	1744	0.499	0.388	RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus OX=10090 GN=Rtl1 PE=2 SV=1
2	Q7TN75	6.88e-40	163	958	0.084	0.119	PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus OX=10090 GN=Peg10 PE=1 SV=2
3	P0CT40	1.00e-27	124	1333	0.070	0.071	TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1
4	Q86TG7	6.86e-21	101	708	0.038	0.073	PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
5	A0A087WXK2	7.03e-21	101	707	0.038	0.074	A0A087WXK2_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
6	A0A087WX23	8.15e-21	101	783	0.038	0.066	A0A087WX23_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=1
7	A0A087WUL4	9.45e-21	101	741	0.038	0.070	A0A087WUL4_HUMAN Paternally expressed 10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
8	A0A087WZG9	1.65e-17	88.2	359	0.037	0.139	A0A087WZG9_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10 PE=1 SV=2
9	Q7LHG5	3.13e-17	90.5	1498	0.052	0.047	YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2
10	Q99315	7.70e-17	89.4	1547	0.051	0.045	YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3
11	A1Z651	1.90e-10	68.2	1733	0.047	0.037	POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) OX=373193 GN=gag-pol PE=1 SV=1
12	P03355	7.90e-10	66.2	1738	0.047	0.037	POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) OX=928306 GN=gag-pol PE=1 SV=5
13	Q17RB0	1.68e-09	58.9	113	0.021	0.257	RTL8B_HUMAN Retrotransposon Gag-like protein 8B OS=Homo sapiens OX=9606 GN=RTL8B PE=1 SV=1
14	Q9BWD3	1.98e-09	58.9	113	0.021	0.257	RTL8A_HUMAN Retrotransposon Gag-like protein 8A OS=Homo sapiens OX=9606 GN=RTL8A PE=1 SV=3
15	Q8UN00	2.17e-09	64.7	1738	0.047	0.037	Q8UN00_MLVMO Gag-Pol polyprotein OS=Moloney murine leukemia virus OX=11801 GN=gag-pro-pol PE=1 SV=1
16	A6ZKI3	1.12e-08	56.6	113	0.021	0.248	RTL8C_HUMAN Retrotransposon Gag-like protein 8C OS=Homo sapiens OX=9606 GN=RTL8C PE=1 SV=1
17	O95751	1.41e-08	57.4	146	0.020	0.185	LDOC1_HUMAN Protein LDOC1 OS=Homo sapiens OX=9606 GN=LDOC1 PE=1 SV=1
18	Q7TPY9	4.15e-08	56.2	151	0.020	0.179	LDOC1_MOUSE Protein LDOC1 OS=Mus musculus OX=10090 GN=Ldoc1 PE=2 SV=1
19	P14350	5.47e-06	53.5	1143	0.032	0.038	POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus OX=11963 GN=pol PE=1 SV=2
20	O82143	1.9	35.0	402	0.018	0.062	PSMDA_ORYSJ 26S proteasome non-ATPase regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=RPN10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13650 Asp_protease_2	0.24	23.4	Aspartyl protease
2	PF16297 DUF4939	1.2e-10	52.6	Domain of unknown function (DUF4939)
3	PF13975 gag-asp_proteas	0.28	23.1	gag-polyprotein putative aspartyl protease
4	PF03732 Retrotrans_gag	1.5e-06	39.7	Retrotransposon gag protein
5	PF17917 RT_RNaseH	0.00012	33.6	RNase H-like domain found in reverse transcriptase
6	PF17919 RT_RNaseH_2	1.9e-17	74.5	RNase H-like domain found in reverse transcriptase
7	PF00078 RVT_1	0.85	20.6	Reverse transcriptase (RNA-dependent DNA polymerase)
8	PF19259 Ty3_capsid	0.017	26.1	Ty3 transposon capsid-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000435342

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340292	0.840	Protein delta homolog 1
2	9606.ENSP00000427336	0.840	Thyroxine 5-deiodinase
3	9606.ENSP00000246337	0.774	Uroporphyrinogen decarboxylase
4	9606.ENSP00000406084	0.698	WD repeat-containing protein 20
5	9606.ENSP00000411124	0.672	Brain-enriched guanylate kinase-associated protein
6	9606.ENSP00000344829	0.661	Glutaminyl-peptide cyclotransferase
7	9606.ENSP00000385300	0.660	Claudin-15
8	9606.ENSP00000355809	0.654	Protein enabled homolog
9	9606.ENSP00000377275	0.650	Golgin subfamily B member 1
10	9606.ENSP00000433352	0.639	LIM domain only protein 7
11	9606.ENSP00000472474	0.633	L-amino-acid oxidase
12	9606.ENSP00000294339	0.626	T-cell acute lymphocytic leukemia protein 1
13	9606.ENSP00000402346	0.623	Coatomer subunit gamma-2
14	9606.ENSP00000269305	0.606	Cellular tumor antigen p53
15	9606.ENSP00000359384	0.595	Oocyte-expressed protein homolog
16	9606.ENSP00000367263	0.595	Neuroblast differentiation-associated protein AHNAK
17	9606.ENSP00000320488	0.570	Nucleosome assembly protein 1 like 5
18	9606.ENSP00000401645	0.556	Plasminogen activator inhibitor 2
19	9606.ENSP00000216223	0.551	Interleukin-2 receptor subunit beta
20	9606.ENSP00000355922	0.549	Centromere protein F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.929	organic cyclic compound binding
GO:1901363	0.925	heterocyclic compound binding
GO:0003676	0.868	nucleic acid binding
GO:0042802	0.428	identical protein binding
GO:0003723	0.402	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0065007	0.853	biological regulation
GO:0050789	0.750	regulation of biological process
GO:0050794	0.740	regulation of cellular process
GO:0008152	0.725	metabolic process
GO:0071704	0.712	organic substance metabolic process
GO:0032502	0.670	developmental process
GO:0032501	0.559	multicellular organismal process
GO:0048856	0.541	anatomical structure development
GO:0007275	0.443	multicellular organism development
GO:0048513	0.412	animal organ development
GO:0001892	0.400	embryonic placenta development
GO:0009653	0.370	anatomical structure morphogenesis
GO:0008283	0.359	cell population proliferation
GO:0048731	0.345	system development
GO:0048519	0.304	negative regulation of biological process
GO:0043170	0.301	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005737	0.985	cytoplasm
GO:0099080	0.971	supramolecular complex
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0030016	0.892	myofibril
GO:0005634	0.849	nucleus
GO:0030017	0.509	sarcomere
GO:0016020	0.392	membrane
GO:0031674	0.343	I band

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]