StarFunc result for job id A6NKT7

User Input

>input (1758 residues)
MSCSKAYGERYVASVQGSAPSPRKKSTRGFYFAKLYYEAKEYDLAKKYICTYINVREMDP
RAHRFLGLLYELEENTEKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAEYWVER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVARCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYA
NLMLLTLSTRDVQESRELLESFDSALQSAKSSLGGNDELSATFLEMKGHFYMHAGSLLLK
MGQHGNNVQWRALSELAALCYLIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLL
NLSRGKQDFLKVVVETFANKSGQSALYDALFSSQSPKDTSFLGSDDIGNIDVQEPELEDL
ARYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPQETSRLETNAPESI
CILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLI
HRKAVPGNSAKLRLLVQHEINTLRAQEKHGLQPALLVHWAKCLQKMGSGLNSFYDQREYI
GRSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHVTFAILDA
VNGNIEDAMTAFESIKSVVSYWNLALIFHRKAEDIANDALSPEEQEECKNYLRKTRGYLI
KILDDSDSNLSVVKKLPVPLESVKEMLKSVMQELENYSEGGPLYKNGSLRNADSEIKHST
PSPTKYSLSPSKSYKYSPKTPPRWAEDQNSLLKMIRQEVKAIKEEMQELKLNSSKSASHH
RWPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTK
GSSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKSEKPLENDTGLQAQDISGRKKGRG
VIFGQTSSTFTFADVAKSTSGEGFQFGKKDLNFKGFSGAGEKLFSSQYGKMANKANTSGD
FEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEGEKVLYSQGVKLFRFDAEVSQWKER
GLGNLKILKNEVNGKVRMLMQREQVLKVCANHWITTTMNLKPLSGSDRAWMWSASDFSDG
DAKLERLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKS
GLKDFKTFLTNDQTKVAEEENKGSGTGAAGASDTTIKPNAENTGPTLEWDNYDLREDALD
DSVSSSSVHASPLASSPVRKNLFHFDESTTGSNFSFKSALSLSKSPAKLNQSGTSVGTDE
ESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAEFYRYDKDVGQWKERGIG
DIKILQNYDNKHVRILMRRDQVLKLCANHRITPDMSLQNMKGTERVWVWTACDFADGERK
VEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAVLEET
TRERTDVIQGDDVADAASEVEVSSTSETTTKAVVSPPKFVFGSESVKRIFSSEKSKPFAF
GNSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKN
LSASFPTEESSINYTFKTPEKEPPLWYAEFTKEELVQKLSSTTKSADHLNGLLREIEATN
AVLMEQIKLLKSEIRRLERNQEQEVSAANVEHLKNVLLQFIFLKPGSERERLLPVINTML
QLSLEEKGKLAAVAQGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5j00	0.413	0.933	2.304E-85	756	0.410	0.954	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:Q8RWG8	0.079	0.587	1.772E-12	217	0.040	0.323	Q8RWG8.pdb.gz	RBP1B_ARATH Ran-binding protein 1 homolog b OS=Arabidopsis thaliana OX=3702 GN=RANBP1B PE=1 SV=2
3	AFDB:F6WQW2	0.084	0.475	1.842E-12	278	0.052	0.327	F6WQW2.pdb.gz	F6WQW2_HUMAN RAN binding protein 1 OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
4	AFDB:Q9LMK7	0.075	0.560	4.335E-12	228	0.042	0.325	Q9LMK7.pdb.gz	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
5	AFDB:P92985	0.078	0.580	6.395E-12	219	0.042	0.333	P92985.pdb.gz	RBP1C_ARATH Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1
6	AFDB:Q09717	0.075	0.576	1.827E-11	215	0.044	0.363	Q09717.pdb.gz	RANG_SCHPO Ran-specific GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sbp1 PE=1 SV=1
7	AFDB:P41920	0.075	0.629	3.540E-11	201	0.047	0.413	P41920.pdb.gz	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
8	PDB:1k5dB	0.076	0.861	5.963E-11	146	0.039	0.466	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
9	AFDB:A0A1D8PRQ3	0.076	0.585	7.411E-11	212	0.040	0.330	A0A1D8PRQ3.pdb.gz	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
10	PDB:3m1iB	0.073	0.943	3.053E-10	131	0.034	0.458	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
11	AFDB:E1C2U2	0.090	0.074	1.663E-9	2326	0.150	0.113	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
12	PDB:7dkhI	0.082	0.140	3.976E-9	914	0.055	0.106	7dkhI.pdb.gz
13	AFDB:Q6PR54	0.072	0.058	6.745E-9	2419	0.129	0.093	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
14	PDB:4bujB	0.096	0.117	1.612E-8	1367	0.054	0.069	4bujB.pdb.gz
15	AFDB:Q86VV4	0.077	0.259	5.953E-8	465	0.046	0.174	Q86VV4.pdb.gz	RNB3L_HUMAN Ran-binding protein 3-like OS=Homo sapiens OX=9606 GN=RANBP3L PE=1 SV=2
16	PDB:6tedQ	0.089	0.153	6.000E-7	890	0.061	0.120	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:7qdrB	0.106	0.143	8.852E-7	1212	0.065	0.095	7qdrB.pdb.gz
18	PDB:6yj6A	0.099	0.186	1.783E-6	819	0.054	0.116	6yj6A.pdb.gz
19	PDB:7ntfA	0.091	0.155	4.533E-6	918	0.034	0.064	7ntfA.pdb.gz
20	PDB:6c95A	0.109	0.222	8.780E-6	773	0.043	0.097	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC36	0.0	1269	3114	0.371	0.210	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
2	D4A054	0.0	1269	3061	0.371	0.213	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
3	M0R3M4	0.0	1270	3089	0.371	0.211	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
4	P49792	0.0	1421	3224	0.403	0.220	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
5	Q9ERU9	0.0	1294	3053	0.371	0.214	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
6	Q8IWJ2	7.03e-58	224	1684	0.066	0.069	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
7	Q8CHG3	2.06e-51	202	1680	0.057	0.060	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
8	P41920	2.05e-39	147	201	0.046	0.398	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
9	P34022	4.75e-37	141	203	0.043	0.374	RANG_MOUSE Ran-specific GTPase-activating protein OS=Mus musculus OX=10090 GN=Ranbp1 PE=1 SV=2
10	A0A140VK94	5.28e-37	141	201	0.042	0.363	A0A140VK94_HUMAN RAN binding protein 1, isoform CRA_g OS=Homo sapiens OX=9606 GN=RANBP1 PE=2 SV=1
11	P43487	5.28e-37	141	201	0.042	0.363	RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
12	A0A8I5ZTU5	7.67e-37	141	219	0.040	0.320	A0A8I5ZTU5_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=1
13	D4A2G9	1.38e-36	139	188	0.040	0.372	D4A2G9_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=2
14	F6WQW2	3.05e-36	141	278	0.043	0.273	F6WQW2_HUMAN RAN binding protein 1 OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
15	A0A1D8PRQ3	1.51e-33	131	212	0.035	0.288	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
16	Q21021	8.90e-33	140	860	0.035	0.071	Q21021_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=2
17	C9JJ34	2.48e-31	123	163	0.036	0.393	C9JJ34_HUMAN RAN binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
18	A0A0B4K7J2	3.46e-30	134	2718	0.042	0.027	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
19	Q09717	1.52e-29	120	215	0.045	0.367	RANG_SCHPO Ran-specific GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sbp1 PE=1 SV=1
20	C9JXG8	1.85e-29	117	145	0.032	0.386	C9JXG8_HUMAN RAN binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01465 GRIP	1.9e-10	51.7	GRIP domain
2	PF17956 NAPRTase_C	3.3e+02	13.0	Nicotinate phosphoribosyltransferase C-terminal domain
3	PF16704 Rab_bind	1.2e-33	126.3	Rab binding domain
4	PF00638 Ran_BP1	1.6e-103	353.0	RanBP1 domain
5	PF00515 TPR_1	0.0083	27.1	Tetratricopeptide repeat
6	PF13414 TPR_11	37	15.4	TPR repeat
7	PF13424 TPR_12	2.4e+02	13.4	Tetratricopeptide repeat
8	PF13428 TPR_14	3.4	19.7	Tetratricopeptide repeat
9	PF13432 TPR_16	24	16.9	Tetratricopeptide repeat
10	PF14559 TPR_19	1.9	20.3	Tetratricopeptide repeat
11	PF07719 TPR_2	0.0099	27.0	Tetratricopeptide repeat
12	PF13174 TPR_6	2.4e+02	13.8	Tetratricopeptide repeat
13	PF13176 TPR_7	98	14.4	Tetratricopeptide repeat
14	PF13181 TPR_8	0.025	25.8	Tetratricopeptide repeat
15	PF13371 TPR_9	4.6e+02	12.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381098	0.769	Glutamate receptor-interacting protein 1
2	9606.ENSP00000446215	0.750	GTP-binding nuclear protein Ran
3	9606.ENSP00000362937	0.718	Regulator of chromosome condensation
4	9606.ENSP00000384863	0.704	Exportin-1
5	9606.ENSP00000401470	0.576	Ran GTPase-activating protein 1
6	9606.ENSP00000336712	0.561	Transportin-1
7	9606.ENSP00000447056	0.557	Uncharacterized protein
8	9606.ENSP00000316032	0.550	Nuclear pore complex protein Nup98-Nup96
9	9606.ENSP00000318821	0.543	GRIP and coiled-coil domain-containing protein 1
10	9606.ENSP00000290158	0.539	Importin subunit beta-1
11	9606.ENSP00000434570	0.513	SOGA family member 3
12	9606.ENSP00000451768	0.513	Protein SOGA3
13	9606.ENSP00000464265	0.512	Ubiquitin B pseudogene 4
14	9606.ENSP00000351856	0.510	POTE ankyrin domain family member C
15	9606.ENSP00000310668	0.509	Nuclear pore complex protein Nup93
16	9606.ENSP00000321038	0.505	Lysoplasmalogenase
17	9606.ENSP00000396523	0.502	Solute carrier family 35 member G6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0019789	0.997	SUMO transferase activity
GO:0031267	0.995	small GTPase binding
GO:0061659	0.975	ubiquitin-like protein ligase activity
GO:0061665	0.973	SUMO ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.954	cellular process
GO:0050896	0.849	response to stimulus
GO:0051179	0.840	localization
GO:0050789	0.807	regulation of biological process
GO:0051641	0.782	cellular localization
GO:0051649	0.732	establishment of localization in cell
GO:0046907	0.698	intracellular transport
GO:0008152	0.601	metabolic process
GO:0071704	0.585	organic substance metabolic process
GO:0051169	0.584	nuclear transport
GO:0006913	0.572	nucleocytoplasmic transport
GO:0050794	0.545	regulation of cellular process
GO:0010243	0.543	response to organonitrogen compound
GO:0043170	0.505	macromolecule metabolic process
GO:0033036	0.474	macromolecule localization
GO:0008104	0.437	protein localization
GO:0071702	0.416	organic substance transport
GO:0071705	0.415	nitrogen compound transport
GO:0006886	0.345	intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005643	0.995	nuclear pore
GO:0070013	0.980	intracellular organelle lumen
GO:0031981	0.970	nuclear lumen
GO:0005829	0.967	cytosol
GO:0016020	0.926	membrane
GO:0005654	0.837	nucleoplasm
GO:0044614	0.390	nuclear pore cytoplasmic filaments
GO:1902494	0.381	catalytic complex
GO:0042175	0.375	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0106068	0.370	SUMO ligase complex
GO:0005642	0.364	annulate lamellae
GO:0042405	0.346	nuclear inclusion body
GO:0044615	0.325	nuclear pore nuclear basket
GO:0043232	0.322	intracellular non-membrane-bounded organelle
GO:0048471	0.318	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]