StarFunc result for job id A6NKU9

User Input

>input (549 residues)
MTSHQPQPQEEQSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGCKRKRECLDES
DDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLAPGVDPSPPRRS
LGCKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRL
LAPGVDPSPPRRSLGCKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVS
LVLPEYYEAFNRLLAPGVDPSPPRRSLGCKRKRECLDESDDEPEKELAPEPEETWVAETL
CGLKMKAKRRRVSLVLPEYYEAFNRLLAPGVDPSPPRRSLGCKRKRECLDESDDEPEKEL
APEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRFLAWDKDLRVSDK
YLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQKIFYFLYGKTHSHIPL
RPKHWFQLCRPMNPRARKNCSQIALFQKRRFQFFCSMRCRAWVSPEELEEIQAYDPEHWV
WARDRAHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4JD55	0.069	0.040	1.976E-1	1292	0.128	0.054	A0A0B4JD55.pdb.gz	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
2	AFDB:Q96PE2	0.068	0.033	2.435E-1	2063	0.146	0.039	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
3	AFDB:Q96DR7	0.070	0.051	2.566E-1	871	0.168	0.106	Q96DR7.pdb.gz	ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26 PE=1 SV=4
4	AFDB:Q9VUQ9	0.077	0.032	3.161E-1	2139	0.149	0.038	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
5	AFDB:F1RET1	0.077	0.028	3.509E-1	2248	0.148	0.036	F1RET1.pdb.gz
6	AFDB:Q38B13	0.069	0.055	4.325E-1	756	0.149	0.108	Q38B13.pdb.gz	Q38B13_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0990 PE=4 SV=1
7	AFDB:P58390	0.057	0.041	6.919E-1	839	0.138	0.091	P58390.pdb.gz	KCNN2_MOUSE Small conductance calcium-activated potassium channel protein 2 OS=Mus musculus OX=10090 GN=Kcnn2 PE=1 SV=2
8	AFDB:F1NW90	0.076	0.056	7.290E-1	823	0.118	0.079	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
9	AFDB:Q9P212	0.076	0.032	7.290E-1	2302	0.158	0.038	Q9P212.pdb.gz	PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens OX=9606 GN=PLCE1 PE=1 SV=3
10	AFDB:A8JNS4	0.096	0.087	8.526E-1	635	0.128	0.110	A8JNS4.pdb.gz	A8JNS4_DROME Starvin, isoform E OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
11	PDB:4l1jB	0.066	0.138	9.057E-1	195	0.026	0.072	4l1jB.pdb.gz
12	PDB:6xz6A	0.071	0.138	1.239	213	0.051	0.131	6xz6A.pdb.gz
13	PDB:1zp2A	0.141	0.305	1.609	227	0.040	0.097	1zp2A.pdb.gz
14	PDB:4fjcE	0.074	0.087	1.695	434	0.016	0.021	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
15	PDB:7c4jB	0.055	0.071	1.695	395	0.047	0.066	7c4jB.pdb.gz
16	PDB:6m58B	0.097	0.097	1.982	550	0.036	0.036	6m58B.pdb.gz
17	PDB:5ls9F	0.055	0.124	2.088	165	0.044	0.145	5ls9F.pdb.gz	Humanized archaeal ferritin as a tool for cell targeted delivery.
18	PDB:3dbrG	0.075	0.080	2.200	508	0.033	0.035	3dbrG.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
19	PDB:5veuL	0.091	0.106	2.200	448	0.042	0.051	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
20	PDB:1sqfA	0.130	0.157	2.318	425	0.035	0.045	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DTA3	2.81e-147	426	265	0.377	0.781	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
2	P0CI01	1.19e-144	424	402	0.437	0.597	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
3	Q495Y8	1.41e-143	421	402	0.437	0.597	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
4	A6NLX3	9.25e-90	277	237	0.277	0.641	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	2.42e-74	239	268	0.230	0.470	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q5MJ68	3.88e-24	104	293	0.115	0.215	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
7	Q9PU13	2.84e-23	102	299	0.122	0.224	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
8	Q9YGL1	4.25e-23	102	298	0.122	0.225	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
9	Q5IBH7	4.02e-16	81.6	310	0.118	0.210	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	A0A384MTT5	1.47e-15	80.1	313	0.104	0.182	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
11	Q5MJ70	1.47e-15	80.1	313	0.104	0.182	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
12	Q4R1K5	3.77e-15	78.6	311	0.104	0.183	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
13	Q1DBP2	0.056	38.5	388	0.046	0.064	Q1DBP2_MYXXD Sensor histidine kinase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=MXAN_1679 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13480 Acetyltransf_6	2e-06	39.5	Acetyltransferase (GNAT) domain
2	PF11662 DUF3263	0.094	23.9	Protein of unknown function (DUF3263)
3	PF07222 PBP_sp32	0.2	22.5	Proacrosin binding protein sp32
4	PF00273 Serum_albumin	6.4	18.0	Serum albumin family
5	PF11357 Spy1	1.6e-49	179.0	Cell cycle regulatory protein
6	PF00522 VPR	0.0027	29.0	VPR/VPX protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.800	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.800	Cyclin-dependent kinase 1
3	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
4	9606.ENSP00000435565	0.561	Maestro heat like repeat family member 1
5	9606.ENSP00000383873	0.560	Tetratricopeptide repeat domain containing
6	9606.ENSP00000254579	0.517	Dynein heavy chain domain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016740	0.324	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0019222	0.981	regulation of metabolic process
GO:0050794	0.971	regulation of cellular process
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0051726	0.914	regulation of cell cycle
GO:0031323	0.910	regulation of cellular metabolic process
GO:0009987	0.900	cellular process
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0048518	0.889	positive regulation of biological process
GO:0080090	0.886	regulation of primary metabolic process
GO:0051246	0.824	regulation of protein metabolic process
GO:0048522	0.787	positive regulation of cellular process
GO:0009893	0.725	positive regulation of metabolic process
GO:0031325	0.575	positive regulation of cellular metabolic process
GO:0016043	0.516	cellular component organization
GO:0006996	0.502	organelle organization
GO:0071704	0.499	organic substance metabolic process
GO:0022414	0.440	reproductive process
GO:0043170	0.437	macromolecule metabolic process
GO:0006807	0.427	nitrogen compound metabolic process
GO:0044238	0.353	primary metabolic process
GO:0045787	0.344	positive regulation of cell cycle
GO:0051173	0.326	positive regulation of nitrogen compound metabolic process
GO:0065009	0.325	regulation of molecular function
GO:0031399	0.324	regulation of protein modification process
GO:0007049	0.321	cell cycle
GO:0045859	0.305	regulation of protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.960	nucleoplasm
GO:0043232	0.934	intracellular non-membrane-bounded organelle
GO:0005737	0.930	cytoplasm
GO:0005829	0.873	cytosol
GO:0032991	0.461	protein-containing complex
GO:0012505	0.358	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.324	Transferases.

[back to server]