StarFunc result for job id A6NLC8

User Input

>input (198 residues)
METGRQTGVSAEMFAMPRDLKGSKKDGIPEDLDGNLEEPRDQEGELRSEDVMDLTEGDNE
ASASAPPAAKRRKTDTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPKA
CIAGLMRSITGRSVSENVAIAMAGIAKVFVGEVVEEALDVCEMWGEMPPLQPKHLREAVR
RLKPKGLFPNSNYKKIMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15544	0.546	0.514	2.426E-16	211	0.621	0.583	Q15544.pdb.gz	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	AFDB:Q99JX1	0.593	0.559	4.264E-16	211	0.540	0.507	Q99JX1.pdb.gz	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	AFDB:P49906	0.549	0.554	7.384E-13	196	0.404	0.408	P49906.pdb.gz	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	AFDB:A0A3B3ITY8	0.350	0.347	5.235E-11	200	0.480	0.475	A0A3B3ITY8.pdb.gz	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
5	AFDB:Q9US54	0.494	0.492	5.573E-11	199	0.328	0.327	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	PDB:7edxk	0.454	0.880	1.143E-10	98	0.384	0.776	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	AFDB:Q9M565	0.521	0.493	1.077E-8	210	0.283	0.267	Q9M565.pdb.gz	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
8	PDB:1bfmA	0.325	0.866	6.519E-3	69	0.076	0.217	1bfmA.pdb.gz
9	PDB:4draH	0.321	0.760	2.144E-2	76	0.071	0.184	4draH.pdb.gz
10	PDB:5z30G	0.300	0.509	2.431E-2	110	0.106	0.191	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
11	PDB:1b67A	0.319	0.881	2.933E-2	68	0.071	0.206	1b67A.pdb.gz
12	PDB:7egdF	0.327	0.159	2.933E-2	412	0.045	0.022	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:2rvqD	0.313	0.465	3.123E-2	129	0.086	0.132	2rvqD.pdb.gz
14	PDB:3b0bC	0.320	0.767	3.325E-2	75	0.076	0.200	3b0bC.pdb.gz
15	PDB:1jfiB	0.324	0.466	3.540E-2	135	0.061	0.089	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
16	PDB:6t9iE	0.318	0.148	4.013E-2	433	0.076	0.035	6t9iE.pdb.gz
17	AFDB:Q12962	0.304	0.278	5.677E-2	218	0.146	0.133	Q12962.pdb.gz	TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1
18	AFDB:Q8IHQ2	0.325	0.055	7.765E-2	1301	0.131	0.020	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
19	AFDB:Q9U226	0.325	0.193	1.131E-1	342	0.126	0.073	Q9U226.pdb.gz	TAF12_CAEEL Transcription initiation factor TFIID subunit 12 OS=Caenorhabditis elegans OX=6239 GN=taf-12 PE=1 SV=2
20	AFDB:P49905	0.327	0.330	1.282E-1	196	0.106	0.107	P49905.pdb.gz	TAF12_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15544	3.70e-71	216	211	0.626	0.588	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	Q99JX1	1.57e-65	202	211	0.596	0.559	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	A0A3B3ITY8	3.31e-41	140	200	0.460	0.455	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
4	P49906	3.86e-38	132	196	0.333	0.337	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
5	Q9US54	2.65e-24	96.7	199	0.242	0.241	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	Q9M565	3.20e-16	75.5	210	0.217	0.205	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
7	Q04226	3.35e-08	54.7	346	0.091	0.052	TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF11 PE=1 SV=1
8	Q86XD5	0.99	32.3	332	0.091	0.054	F131B_HUMAN Protein FAM131B OS=Homo sapiens OX=9606 GN=FAM131B PE=1 SV=3
9	G0S0E7	2.4	31.6	1262	0.096	0.015	NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP120 PE=1 SV=1
10	Q8TF80	4.6	30.0	269	0.126	0.093	WTF5_SCHPO Meiotic drive suppressor wtf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wtf5 PE=3 SV=1
11	P48987	5.5	30.0	312	0.136	0.087	ATO_DROME Protein atonal OS=Drosophila melanogaster OX=7227 GN=ato PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	1.4	20.5	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF14695 LINES_C	1.8e+02	12.9	Lines C-terminus
3	PF04719 TAFII28	1.5e-28	110.0	hTAFII28-like protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020068

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002710	0.924	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
2	9593.ENSGGOP00000007336	0.924	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
3	9593.ENSGGOP00000000388	0.921	Transcription initiation factor TFIID subunit 10
4	9593.ENSGGOP00000008371	0.914	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
5	9593.ENSGGOP00000008899	0.913	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
6	9593.ENSGGOP00000005330	0.889	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
7	9593.ENSGGOP00000027533	0.888	TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
8	9593.ENSGGOP00000016296	0.883	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
9	9593.ENSGGOP00000002080	0.859	Uncharacterized protein
10	9593.ENSGGOP00000003902	0.859	TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
11	9593.ENSGGOP00000009307	0.855	Uncharacterized protein
12	9593.ENSGGOP00000023578	0.855	Uncharacterized protein
13	9593.ENSGGOP00000001038	0.851	TATA box binding protein like 2
14	9593.ENSGGOP00000002430	0.851	TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
15	9593.ENSGGOP00000004050	0.851	TATA-box binding protein associated factor 9
16	9593.ENSGGOP00000011550	0.851	TATA box binding protein
17	9593.ENSGGOP00000015303	0.851	Transcription initiation factor TFIID subunit
18	9593.ENSGGOP00000026097	0.851	Transcription initiation factor TFIID subunit
19	9593.ENSGGOP00000018571	0.846	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
20	9593.ENSGGOP00000011524	0.836	TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140223	0.965	general transcription initiation factor activity
GO:0016251	0.963	RNA polymerase II general transcription initiation factor activity
GO:0008134	0.889	transcription factor binding
GO:0097159	0.732	organic cyclic compound binding
GO:1901363	0.731	heterocyclic compound binding
GO:0003676	0.711	nucleic acid binding
GO:0003677	0.703	DNA binding
GO:0140296	0.533	general transcription initiation factor binding
GO:0061629	0.509	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.351	nuclear receptor binding
GO:0140110	0.319	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050789	0.984	regulation of biological process
GO:0048518	0.973	positive regulation of biological process
GO:0010468	0.970	regulation of gene expression
GO:0009987	0.965	cellular process
GO:0050794	0.935	regulation of cellular process
GO:0071704	0.926	organic substance metabolic process
GO:0044237	0.926	cellular metabolic process
GO:0044238	0.925	primary metabolic process
GO:0006807	0.914	nitrogen compound metabolic process
GO:0006139	0.890	nucleobase-containing compound metabolic process
GO:1901576	0.882	organic substance biosynthetic process
GO:0044249	0.882	cellular biosynthetic process
GO:0043170	0.881	macromolecule metabolic process
GO:0009059	0.872	macromolecule biosynthetic process
GO:0034654	0.869	nucleobase-containing compound biosynthetic process
GO:0097659	0.849	nucleic acid-templated transcription
GO:0006351	0.841	DNA-templated transcription
GO:0006366	0.818	transcription by RNA polymerase II
GO:0080090	0.796	regulation of primary metabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0048522	0.790	positive regulation of cellular process
GO:0009893	0.767	positive regulation of metabolic process
GO:0010604	0.764	positive regulation of macromolecule metabolic process
GO:0051171	0.737	regulation of nitrogen compound metabolic process
GO:0019219	0.714	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.706	cellular component organization or biogenesis
GO:0016043	0.699	cellular component organization
GO:0051252	0.695	regulation of RNA metabolic process
GO:0006367	0.663	transcription initiation at RNA polymerase II promoter
GO:0010556	0.627	regulation of macromolecule biosynthetic process
GO:0031326	0.627	regulation of cellular biosynthetic process
GO:0006355	0.618	regulation of DNA-templated transcription
GO:0045935	0.613	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.548	positive regulation of RNA metabolic process
GO:1903508	0.436	positive regulation of nucleic acid-templated transcription
GO:0045893	0.431	positive regulation of DNA-templated transcription
GO:0006357	0.402	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.991	nucleoplasm
GO:0032991	0.870	protein-containing complex
GO:0005737	0.845	cytoplasm
GO:0005667	0.586	transcription regulator complex
GO:1902494	0.332	catalytic complex
GO:1990234	0.320	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]