StarFunc result for job id A6NLP5

User Input

>input (189 residues)
MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVM
AAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGR
AARQSFVQRGLLARLQGRDDDARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMG
QLRRPRDSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VBW8	0.898	0.912	6.801E-21	186	0.878	0.892	Q8VBW8.pdb.gz	TTC36_MOUSE Tetratricopeptide repeat protein 36 OS=Mus musculus OX=10090 GN=Ttc36 PE=1 SV=1
2	AFDB:A8E7I5	0.733	0.740	1.570E-14	187	0.587	0.594	A8E7I5.pdb.gz	TTC36_DANRE Tetratricopeptide repeat protein 36 OS=Danio rerio OX=7955 GN=ttc36 PE=2 SV=1
3	AFDB:Q12118	0.567	0.320	1.988E-5	346	0.148	0.081	Q12118.pdb.gz	SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGT2 PE=1 SV=1
4	PDB:7obeA	0.555	0.228	2.612E-5	480	0.159	0.062	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
5	AFDB:Q8IZP2	0.555	0.446	2.905E-5	240	0.185	0.146	Q8IZP2.pdb.gz	ST134_HUMAN Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1
6	AFDB:Q6PID6	0.560	0.413	3.349E-5	262	0.185	0.134	Q6PID6.pdb.gz	TTC33_HUMAN Tetratricopeptide repeat protein 33 OS=Homo sapiens OX=9606 GN=TTC33 PE=1 SV=2
7	AFDB:O43765	0.559	0.347	3.512E-5	313	0.212	0.128	O43765.pdb.gz	SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1
8	AFDB:G1TAF8	0.557	0.206	4.049E-5	543	0.180	0.063	G1TAF8.pdb.gz	G1TAF8_RABIT Stress induced phosphoprotein 1 OS=Oryctolagus cuniculus OX=9986 GN=STIP1 PE=4 SV=2
9	AFDB:O70593	0.558	0.345	4.049E-5	314	0.206	0.124	O70593.pdb.gz	SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus OX=10116 GN=Sgta PE=1 SV=1
10	AFDB:Q84XU2	0.556	0.204	4.894E-5	538	0.185	0.065	Q84XU2.pdb.gz	PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana OX=3702 GN=PAPP5 PE=1 SV=1
11	AFDB:Q99L47	0.560	0.300	7.152E-5	371	0.180	0.092	Q99L47.pdb.gz	F10A1_MOUSE Hsc70-interacting protein OS=Mus musculus OX=10090 GN=St13 PE=1 SV=1
12	PDB:5njxA	0.540	0.263	1.914E-4	413	0.164	0.075	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
13	PDB:6yj6A	0.429	0.118	1.006E-3	819	0.153	0.035	6yj6A.pdb.gz
14	PDB:2y4uA	0.450	0.226	1.055E-3	424	0.111	0.050	2y4uA.pdb.gz
15	PDB:7kw7E	0.608	0.363	1.106E-3	327	0.132	0.076	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
16	PDB:8a3tD	0.548	0.199	1.106E-3	560	0.132	0.045	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
17	PDB:1wao1	0.548	0.231	1.695E-3	471	0.164	0.066	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
18	PDB:7qe7J	0.505	0.198	1.864E-3	510	0.153	0.057	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:7qe7U	0.533	0.200	2.148E-3	540	0.138	0.048	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	PDB:2c2lA	0.478	0.328	2.597E-3	281	0.143	0.096	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VBW8	7.75e-109	310	186	0.878	0.892	TTC36_MOUSE Tetratricopeptide repeat protein 36 OS=Mus musculus OX=10090 GN=Ttc36 PE=1 SV=1
2	A8E7I5	4.34e-73	220	187	0.587	0.594	TTC36_DANRE Tetratricopeptide repeat protein 36 OS=Danio rerio OX=7955 GN=ttc36 PE=2 SV=1
3	Q4WHU0	3.66e-05	45.1	256	0.328	0.242	HMGX_ASPFU L-tyrosine degradation gene cluster protein hmgX OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hmgX PE=2 SV=1
4	Q7ZWU1	4.38e-05	45.4	543	0.153	0.053	STIP1_XENLA Stress-induced-phosphoprotein 1 OS=Xenopus laevis OX=8355 GN=stip1 PE=2 SV=1
5	Q60864	4.63e-05	45.4	543	0.153	0.053	STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus OX=10090 GN=Stip1 PE=1 SV=1
6	O35814	4.72e-05	45.4	543	0.153	0.053	STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Stip1 PE=1 SV=1
7	G1TAF8	1.26e-04	43.9	543	0.159	0.055	G1TAF8_RABIT Stress induced phosphoprotein 1 OS=Oryctolagus cuniculus OX=9986 GN=STIP1 PE=4 SV=2
8	P31948	1.45e-04	43.9	543	0.148	0.052	STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1
9	Q27968	4.19e-04	42.4	504	0.196	0.073	DNJC3_BOVIN DnaJ homolog subfamily C member 3 OS=Bos taurus OX=9913 GN=DNAJC3 PE=1 SV=1
10	O13797	8.72e-04	41.2	317	0.153	0.091	SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgt2 PE=3 SV=1
11	A0A0R4IVJ0	0.001	40.8	1102	0.212	0.036	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
12	O15294	0.001	41.2	1046	0.153	0.028	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
13	P56558	0.001	41.6	1036	0.153	0.028	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
14	P81436	0.001	41.2	1046	0.153	0.028	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
15	Q13217	0.001	40.8	504	0.190	0.071	DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1
16	Q5GA10	0.001	40.8	1036	0.153	0.028	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
17	Q5GA11	0.001	40.8	1046	0.212	0.038	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
18	Q5GA12	0.001	41.2	1052	0.212	0.038	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
19	Q5GA13	0.001	41.2	1062	0.212	0.038	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
20	Q5I0X7	0.001	40.0	151	0.138	0.172	TTC32_HUMAN Tetratricopeptide repeat protein 32 OS=Homo sapiens OX=9606 GN=TTC32 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07219 HemY_N	72	15.0	HemY protein N-terminus
2	PF10516 SHNi-TPR	0.8	20.5	SHNi-TPR
3	PF00515 TPR_1	7.6e-07	39.9	Tetratricopeptide repeat
4	PF13374 TPR_10	0.091	23.9	Tetratricopeptide repeat
5	PF13414 TPR_11	0.00059	30.8	TPR repeat
6	PF13424 TPR_12	0.00021	32.9	Tetratricopeptide repeat
7	PF13428 TPR_14	92	15.3	Tetratricopeptide repeat
8	PF13432 TPR_16	0.12	24.3	Tetratricopeptide repeat
9	PF13431 TPR_17	6.8e+02	12.1	Tetratricopeptide repeat
10	PF14559 TPR_19	30	16.5	Tetratricopeptide repeat
11	PF07719 TPR_2	2e-08	44.8	Tetratricopeptide repeat
12	PF13174 TPR_6	32	16.6	Tetratricopeptide repeat
13	PF13176 TPR_7	3.7	18.8	Tetratricopeptide repeat
14	PF13181 TPR_8	0.92	20.9	Tetratricopeptide repeat
15	PF13371 TPR_9	0.16	23.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307640

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325266	0.789	Tetratricopeptide repeat domain containing
2	9606.ENSP00000323645	0.777	Tetratricopeptide repeat domain containing
3	9606.ENSP00000419279	0.747	Intraflagellar transport protein 56
4	9606.ENSP00000261593	0.718	E3 ubiquitin-protein ligase RNF138
5	9606.ENSP00000302961	0.704	Heat shock protein family A member 4
6	9606.ENSP00000380514	0.704	Hydroxyacylglutathione hydrolase, mitochondrial
7	9606.ENSP00000360329	0.694	Tetratricopeptide repeat domain containing
8	9606.ENSP00000351789	0.691	E3 ubiquitin-protein ligase pellino homolog 1
9	9606.ENSP00000478589	0.669	Tetratricopeptide repeat protein 25
10	9606.ENSP00000291670	0.658	Formimidoyltransferase-cyclodeaminase
11	9606.ENSP00000294973	0.649	3-hydroxyanthranilate 3,4-dioxygenase
12	9606.ENSP00000302620	0.641	Alanine-glyoxylate aminotransferase
13	9606.ENSP00000283871	0.640	Homogentisate 1,2-dioxygenase
14	9606.ENSP00000416750	0.635	Serine/threonine-protein kinase 33
15	9606.ENSP00000356382	0.632	Coagulation factor XIII B chain
16	9606.ENSP00000394178	0.632	Transmembrane protein 182
17	9606.ENSP00000258821	0.592	Tetratricopeptide repeat protein 5
18	9606.ENSP00000265605	0.561	Aldehyde dehydrogenase family 8 member A1
19	9606.ENSP00000317721	0.558	Peroxisomal sarcosine oxidase
20	9606.ENSP00000289416	0.552	Acyl-coenzyme A synthetase ACSM3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.949	regulation of biological process
GO:0080090	0.914	regulation of primary metabolic process
GO:0008152	0.905	metabolic process
GO:0060255	0.898	regulation of macromolecule metabolic process
GO:0051171	0.897	regulation of nitrogen compound metabolic process
GO:0071704	0.894	organic substance metabolic process
GO:0032501	0.859	multicellular organismal process
GO:0050794	0.826	regulation of cellular process
GO:0051246	0.821	regulation of protein metabolic process
GO:0044237	0.818	cellular metabolic process
GO:0048519	0.794	negative regulation of biological process
GO:0009894	0.739	regulation of catabolic process
GO:0044238	0.736	primary metabolic process
GO:0006807	0.698	nitrogen compound metabolic process
GO:1903050	0.678	regulation of proteolysis involved in protein catabolic process
GO:0048856	0.671	anatomical structure development
GO:0061136	0.658	regulation of proteasomal protein catabolic process
GO:0051248	0.654	negative regulation of protein metabolic process
GO:1901564	0.645	organonitrogen compound metabolic process
GO:0031399	0.641	regulation of protein modification process
GO:0007275	0.640	multicellular organism development
GO:0031400	0.614	negative regulation of protein modification process
GO:0032091	0.593	negative regulation of protein binding
GO:0048731	0.585	system development
GO:0050896	0.557	response to stimulus
GO:1901360	0.478	organic cyclic compound metabolic process
GO:0044281	0.454	small molecule metabolic process
GO:0031323	0.407	regulation of cellular metabolic process
GO:0019752	0.402	carboxylic acid metabolic process
GO:0006725	0.400	cellular aromatic compound metabolic process
GO:1901605	0.359	alpha-amino acid metabolic process
GO:0048523	0.326	negative regulation of cellular process
GO:0031329	0.326	regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.994	cytosol
GO:0043226	0.982	organelle
GO:0043227	0.974	membrane-bounded organelle
GO:0043229	0.968	intracellular organelle
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0070013	0.466	intracellular organelle lumen
GO:0032991	0.300	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]