StarFunc result for job id A6NLX3

User Input

>input (237 residues)
MASGQARPPFEEESPQPSTTVRSPEVVVDDEVPGPSAPWIDPSPQPQSLGLKRKSEWSDE
SEEELEEELELERAPEPEDTWVVETLCGLKMKLKRKRASSVLPEHHEAFNRLLGDPVVQK
FLAWDKDLRVSDKYLLAMVIAYFSRAGLFSWQYQRIHFFLALYLASDMEEDNQAPKQDIF
SFLYGKNYSQRPLFHKLRYQLLCSMRWRTWVSPEEMEEIQAYDPEHWVWARDRTLIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NLX3	1.000	1.000	1.829E-36	237	1.000	1.000	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
2	AFDB:Q5IBH6	0.673	0.601	3.172E-26	268	0.633	0.560	Q5IBH6.pdb.gz	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
3	AFDB:P0DTA3	0.613	0.550	1.429E-22	265	0.705	0.630	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	AFDB:P0CI01	0.627	0.377	3.367E-22	402	0.705	0.415	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
5	AFDB:Q9YGL1	0.557	0.445	2.345E-13	298	0.291	0.232	Q9YGL1.pdb.gz	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
6	AFDB:Q9PU13	0.557	0.444	4.007E-13	299	0.291	0.231	Q9PU13.pdb.gz	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	AFDB:Q5MJ68	0.533	0.433	1.376E-11	293	0.287	0.232	Q5MJ68.pdb.gz	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
8	AFDB:A0A384MTT5	0.569	0.434	2.003E-11	313	0.270	0.204	A0A384MTT5.pdb.gz	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
9	AFDB:Q5IBH7	0.563	0.435	8.978E-11	310	0.270	0.206	Q5IBH7.pdb.gz	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	AFDB:C8VF25	0.347	0.222	4.073E-2	390	0.173	0.105	C8VF25.pdb.gz	C8VF25_EMENI PHO80-like cyclin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05156 PE=4 SV=1
11	PDB:7kpvB	0.315	0.265	3.383E-1	290	0.097	0.079	7kpvB.pdb.gz
12	PDB:7egb9	0.337	0.285	4.422E-1	287	0.089	0.073	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:2w96A	0.307	0.295	4.922E-1	249	0.076	0.072	2w96A.pdb.gz
14	PDB:1zp2A	0.331	0.343	7.163E-1	227	0.076	0.079	1zp2A.pdb.gz
15	PDB:1g3nC	0.269	0.273	8.875E-1	233	0.089	0.090	1g3nC.pdb.gz
16	PDB:1sqfA	0.216	0.145	8.875E-1	425	0.080	0.045	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
17	PDB:7mbyR	0.121	0.105	9.363E-1	283	0.084	0.071	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
18	PDB:6kvgA	0.239	0.223	1.224	256	0.059	0.055	6kvgA.pdb.gz
19	PDB:5hbhB	0.304	0.273	1.437	270	0.089	0.078	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
20	PDB:1ekuB	0.177	0.168	1.517	254	0.097	0.091	1ekuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NLX3	4.41e-176	484	237	1.000	1.000	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
2	P0DTA3	6.50e-106	308	265	0.709	0.634	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
3	Q5IBH6	3.10e-104	304	268	0.637	0.563	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
4	P0CI01	2.50e-70	222	402	0.515	0.303	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
5	Q495Y8	4.52e-70	221	402	0.515	0.303	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
6	Q9YGL1	4.94e-30	115	298	0.270	0.215	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
7	Q9PU13	6.09e-30	115	299	0.270	0.214	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
8	Q5MJ68	3.33e-27	107	293	0.295	0.239	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q5IBH7	2.19e-24	100	310	0.274	0.210	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	Q4R1K5	9.11e-23	96.3	311	0.249	0.190	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
11	A0A384MTT5	1.24e-22	95.9	313	0.270	0.204	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
12	Q5MJ70	1.24e-22	95.9	313	0.270	0.204	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
13	Q9H6Z4	0.21	35.0	567	0.114	0.048	RANB3_HUMAN Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1
14	A0A384ME25	0.24	34.7	397	0.114	0.068	A0A384ME25_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
15	Q8JFF9	0.76	33.1	554	0.110	0.047	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
16	Q9P2E9	4.2	31.2	1410	0.156	0.026	RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5
17	F1M853	5.5	30.8	1453	0.148	0.024	F1M853_RAT Ribosome binding protein 1 OS=Rattus norvegicus OX=10116 GN=Rrbp1 PE=1 SV=3
18	O49289	8.1	30.0	845	0.076	0.021	RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana OX=3702 GN=RH29 PE=3 SV=1
19	Q8T6B4	8.3	30.0	1142	0.068	0.014	ABCF4_DICDI ABC transporter F family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcF4 PE=3 SV=1
20	A0A669KB12	10.0	30.0	2388	0.076	0.008	A0A669KB12_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	2.3e-56	201.1	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329522

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.800	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.800	Cyclin-dependent kinase 1
3	9606.ENSP00000382000	0.653	CMT1A duplicated region transcript 15 like 2
4	9606.ENSP00000410111	0.653	TBC1 domain family member 26
5	9606.ENSP00000437812	0.652	Protein FAM106A
6	9606.ENSP00000339973	0.632	TBC1 domain family member 28
7	9606.ENSP00000353717	0.605	Coiled-coil domain containing 144A
8	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
9	9606.ENSP00000297307	0.595	Solute carrier family 35 member G3
10	9606.ENSP00000331466	0.595	Transmembrane protein 95
11	9606.ENSP00000396523	0.595	Solute carrier family 35 member G6
12	9606.ENSP00000456861	0.595	TBC1 domain family member 3G
13	9606.ENSP00000269127	0.593	Uncharacterized protein C17orf64
14	9606.ENSP00000379242	0.563	CMT1A duplicated region transcript 1 protein
15	9606.ENSP00000386180	0.561	Olfactory receptor 3A2
16	9606.ENSP00000330051	0.559	Major facilitator superfamily domain containing 6 like
17	9606.ENSP00000367157	0.559	Leucine-rich repeat-containing protein 3C
18	9606.ENSP00000462799	0.556	TBC1 domain family member 29
19	9606.ENSP00000463361	0.556	Small integral membrane protein 6
20	9606.ENSP00000484556	0.519	TBC1 domain family member 3B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.813	enzyme binding
GO:0019901	0.504	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042325	0.987	regulation of phosphorylation
GO:0045787	0.966	positive regulation of cell cycle
GO:0045860	0.961	positive regulation of protein kinase activity
GO:0000079	0.919	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0009987	0.875	cellular process
GO:0045737	0.439	positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0008152	0.426	metabolic process
GO:0044237	0.419	cellular metabolic process
GO:0071704	0.412	organic substance metabolic process
GO:0044238	0.378	primary metabolic process
GO:0006807	0.374	nitrogen compound metabolic process
GO:0007049	0.334	cell cycle
GO:0043170	0.331	macromolecule metabolic process
GO:0022402	0.312	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.992	cytoplasm
GO:0005634	0.985	nucleus
GO:0070013	0.969	intracellular organelle lumen
GO:0031981	0.894	nuclear lumen
GO:0016020	0.860	membrane
GO:0005654	0.788	nucleoplasm
GO:0005829	0.703	cytosol
GO:0012505	0.669	endomembrane system
GO:0043232	0.366	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]