StarFunc result for job id A6NM11

User Input

>input (1700 residues)
MSSAQCPALVCVMSRLRFWGPWPLLMWQLLWLLVKEAQPLEWVKDPLQLTSNPLGPPDSW
SSHSSHFPRESPHAPTLPADPWDFDHLGPSASSEMPAPPQESTENLVPFLDTWDSAGEQP
LEPEQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWSLAEIIGITRQLSTPQSQKQTL
QNEYSSTDTPYPGSLPPELRVKSDEPPGPSEQVGPSQFHLEPETQNPETLEDIQSSSLQQ
EAPAQLPQLLEEEPSSMQQEAPALPPESSMESLTLPNHEVSVQPPGEDQAYYHLPNITVK
PADVEVTITSEPTNETESSQAQQETPIQFPEEVEPSATQQEAPIEPPVPPMEHELSISEQ
QQPVQPSESPREVESSPTQQETPGQPPEHHEVTVSPPGHHQTHHLASPSVSVKPPDVQLT
IAAEPSAEVGTSLVHQEATTRLSGSGNDVEPPAIQHGGPPLLPESSEEAGPLAVQQETSF
QSPEPINNENPSPTQQEAAAEHPQTAEEGESSLTHQEAPAQTPEFPNVVVAQPPEHSHLT
QATVQPLDLGFTITPESKTEVELSPTMKETPTQPPKKVVPQLRVYQGVTNPTPGQDQAQH
PVSPSVTVQLLDLGLTITPEPTTEVGHSTPPKRTIVSPKHPEVTLPHPDQVQTQHSHLTR
ATVQPLDLGFTITPKSMTEVEPSTALMTTAPPPGHPEVTLPPSDKGQAQHSHLTQATVQP
LDLELTITTKPTTEVKPSPTTEETSTQPPDLGLAIIPEPTTETRHSTALEKTTAPRPDRV
QTLHRSLTEVTGPPTELEPAQDSLVQSESYTQNKALTAPEEHKASTSTNICELCTCGDEM
LSCIDLNPEQRLRQVPVPEPNTHNGTFTILNFQGNYISYIDGNVWKAYSWTEKLILRENN
LTELHKDSFEGLLSLQYLDLSCNKIQSIERHTFEPLPFLKFINLSCNVITELSFGTFQAW
HGMQFLHKLILNHNPLTTVEDPYLFKLPALKYLDMGTTLVPLTTLKNILMMTVELEKLIL
PSHMACCLCQFKNSIEAVCKTVKLHCNSACLTNTTHCPEEASVGNPEGAFMKVLQARKNY
TSTELIVEPEEPSDSSGINLSGFGSEQLDTNDESDFISTLSYILPYFSAVNLDVKSLLLP
FIKLPTTGNSLAKIQTVGQNRQRVKRVLMGPRSIQKRHFKEVGRQSIRREQGAQASVENA
AEEKRLGSPAPREVEQPHTQQGPEKLAGNAVYTKPSFTQEHKAAVSVLKPFSKGAPSTSS
PAKALPQVRDRWKDLTHAISILESAKARVTNTKTSKPIVHARKKYRFHKTRSHVTHRTPK
VKKSPKVRKKSYLSRLMLANRLPFSAAKSLINSPSQGAFSSLGDLSPQENPFLEVSAPSE
HFIENNNTKHTTARNAFEENDFMENTNMPEGTISENTNYNHPHEADSAGTAFNLGPTVKQ
TETKWEYNNVGTDLSPEPKSFNYPLLSSPGDQFEIQLTQQLQSLIPNNNVRRLIAHVIRT
LKMDCSGAHVQVTCAKLISRTGHLMKLLSGQQEVKASKIEWDTDQWKIENYINESTEAQS
EQKEKSLELKKEVPGYGYTDKLILALIVTGILTILIILFCLIVICCHRRSLQEDEEGFSR
GIFRFLPWRGCSSRRESQDGLSSFGQPLWFKDMYKPLSATRINNHAWKLHKKSSNEDKIL
NRDPGDSEAPTEEEESEALP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6gffI	0.078	0.197	6.645E-7	551	0.035	0.107	6gffI.pdb.gz
2	AFDB:Q95TJ2	0.052	0.064	1.833E-6	1261	0.114	0.154	Q95TJ2.pdb.gz	Q95TJ2_DROME LP06813p OS=Drosophila melanogaster OX=7227 GN=Sdb PE=2 SV=1
3	PDB:2ft3F	0.080	0.323	3.032E-6	305	0.028	0.154	2ft3F.pdb.gz
4	PDB:1xcdA	0.087	0.371	7.278E-6	305	0.031	0.170	1xcdA.pdb.gz
5	AFDB:P34288	0.043	0.045	7.443E-6	1605	0.128	0.136	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
6	PDB:5y31B	0.074	0.237	1.467E-5	511	0.022	0.072	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
7	PDB:7wrqA	0.076	0.193	3.133E-5	566	0.021	0.064	7wrqA.pdb.gz
8	AFDB:F1RCL8	0.034	0.033	5.110E-5	1796	0.135	0.128	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
9	AFDB:Q586D9	0.039	0.034	5.110E-5	2060	0.105	0.087	Q586D9.pdb.gz	Q586D9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.170 PE=4 SV=1
10	PDB:7wv3A	0.080	0.189	5.298E-5	668	0.021	0.054	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
11	PDB:6hkwA	0.080	0.360	1.429E-4	306	0.022	0.124	6hkwA.pdb.gz
12	AFDB:O76894	0.030	0.029	2.945E-4	1795	0.139	0.132	O76894.pdb.gz	O76894_DROME EG:56G7.1 protein OS=Drosophila melanogaster OX=7227 GN=Mur2B PE=4 SV=2
13	PDB:6zxdk	0.077	0.283	3.431E-4	430	0.024	0.095	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
14	AFDB:Q5T5U3	0.040	0.036	3.943E-4	1958	0.148	0.129	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
15	PDB:5yq5B	0.076	0.299	5.474E-4	306	0.029	0.160	5yq5B.pdb.gz
16	AFDB:H2KYH3	0.033	0.027	6.291E-4	2476	0.128	0.088	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
17	PDB:7lt9A	0.074	0.425	6.521E-4	251	0.022	0.147	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
18	AFDB:Q8INM3	0.032	0.035	6.669E-4	1420	0.124	0.149	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
19	AFDB:C7IW64	0.038	0.034	1.697E-3	1952	0.114	0.099	C7IW64.pdb.gz	ROS1A_ORYSJ Protein ROS1A OS=Oryza sativa subsp. japonica OX=39947 GN=ROS1A PE=1 SV=2
20	AFDB:Q6DFV3	0.042	0.038	1.907E-3	1944	0.136	0.119	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80ZD9	1.30e-09	65.1	519	0.037	0.121	AMGO2_MOUSE Amphoterin-induced protein 2 OS=Mus musculus OX=10090 GN=Amigo2 PE=1 SV=1
2	Q8IW52	1.31e-09	65.5	837	0.029	0.060	SLIK4_HUMAN SLIT and NTRK-like protein 4 OS=Homo sapiens OX=9606 GN=SLITRK4 PE=1 SV=1
3	Q810B8	1.50e-09	65.5	837	0.029	0.060	SLIK4_MOUSE SLIT and NTRK-like protein 4 OS=Mus musculus OX=10090 GN=Slitrk4 PE=1 SV=2
4	Q9U3A0	3.22e-09	63.9	594	0.030	0.086	PAN1_CAEEL P-granule-associated novel protein 1 OS=Caenorhabditis elegans OX=6239 GN=pan-1 PE=1 SV=1
5	Q7M6Z0	1.66e-08	61.2	420	0.026	0.107	R4RL2_MOUSE Reticulon-4 receptor-like 2 OS=Mus musculus OX=10090 GN=Rtn4rl2 PE=1 SV=1
6	Q96PE1	1.74e-08	62.4	1338	0.029	0.037	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
7	Q80WD1	2.04e-08	60.8	420	0.026	0.107	R4RL2_RAT Reticulon-4 receptor-like 2 OS=Rattus norvegicus OX=10116 GN=Rtn4rl2 PE=1 SV=1
8	Q810C0	2.32e-08	61.6	846	0.039	0.079	SLIK2_MOUSE SLIT and NTRK-like protein 2 OS=Mus musculus OX=10090 GN=Slitrk2 PE=1 SV=1
9	D3ZK41	2.42e-08	61.6	846	0.039	0.079	D3ZK41_RAT SLIT and NTRK-like family, member 2 OS=Rattus norvegicus OX=10116 GN=Slitrk2 PE=4 SV=2
10	Q3V1M1	2.48e-08	62.0	2594	0.030	0.020	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
11	Q6WRH9	2.91e-08	61.6	2597	0.030	0.020	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
12	Q91ZV8	3.82e-08	61.2	1336	0.025	0.032	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
13	Q9H156	5.61e-08	60.5	845	0.039	0.078	SLIK2_HUMAN SLIT and NTRK-like protein 2 OS=Homo sapiens OX=9606 GN=SLITRK2 PE=1 SV=1
14	Q5U1A7	8.21e-08	59.7	738	0.024	0.054	Q5U1A7_DROME Fish-lips, isoform C OS=Drosophila melanogaster OX=7227 GN=Fili PE=2 SV=1
15	Q52KR2	8.43e-08	59.7	1054	0.027	0.044	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
16	Q7L0X0	2.45e-07	58.2	811	0.030	0.063	TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2
17	Q6P1C6	3.96e-07	57.8	1117	0.027	0.041	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
18	Q86UN3	4.01e-07	57.0	420	0.025	0.102	R4RL2_HUMAN Reticulon-4 receptor-like 2 OS=Homo sapiens OX=9606 GN=RTN4RL2 PE=1 SV=1
19	O94898	4.47e-07	57.4	1065	0.026	0.042	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
20	B8JKM0	4.82e-07	57.0	524	0.030	0.097	B8JKM0_DANRE Leucine-rich repeat transmembrane neuronal 1 OS=Danio rerio OX=7955 GN=lrrtm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06365 CD34_antigen	6.3	17.9	CD34/Podocalyxin family
2	PF15779 LRRC37	9e-89	303.2	Leucine-rich repeat-containing protein 37 family
3	PF14914 LRRC37AB_C	1.3e-68	240.9	LRRC37A/B like protein 1 C-terminal domain
4	PF12799 LRR_4	3e-05	35.5	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	14	17.1	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	6.2e+02	12.0	Leucine Rich repeat
7	PF13855 LRR_8	3.8e-15	66.7	Leucine rich repeat
8	PF14580 LRR_9	1.5e+02	13.4	Leucine-rich repeat
9	PF05510 Sarcoglycan_2	0.32	21.3	Sarcoglycan alpha/epsilon
10	PF15102 TMEM154	2.4e+02	12.9	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000459551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337478	0.691	ADP ribosylation factor like GTPase 17A
2	9606.ENSP00000404247	0.675	ADP-ribosylation factor-like protein 17
3	9606.ENSP00000262419	0.611	KAT8 regulatory NSL complex subunit 1
4	9606.ENSP00000308515	0.593	dephospho-CoA kinase domain containing
5	9606.ENSP00000369513	0.503	V-type proton ATPase subunit S1-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.564	response to stimulus
GO:0032501	0.509	multicellular organismal process
GO:0048518	0.503	positive regulation of biological process
GO:0048522	0.389	positive regulation of cellular process
GO:0051716	0.385	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.992	cytoplasm
GO:0070013	0.986	intracellular organelle lumen
GO:0012505	0.980	endomembrane system
GO:0016020	0.925	membrane
GO:0071944	0.918	cell periphery
GO:0005794	0.797	Golgi apparatus
GO:0005886	0.535	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]