StarFunc result for job id A6NM62

User Input

>input (1247 residues)
MLRLVAACPESCVVCTKDVTLCHQLTYIVAAPMTTRVLIITDGYLSSIESTNLSLLFNLA
LLSLSRNGIEDVQEDALHGLTMLRTLLLEHNQISSSSLTDHTFSKLHSLQVLVLSNNALR
TLRGSWFRNTSGLTRLQLDGNQITNLTDSSFGGTNLHSLRYLDLSNNFISYIGKDAFRPL
PQLQEVDLSRNRLAHMPDVFTPLKQLILLSLDKNQWSCTCDLHPLARFLRNYIKSSAHTL
RNAKDLNCQPSTAAVAAAQSVLRLSETNCDSKAPNFTLVLKDRSPLLPGPDVALLTVLGF
AGAVGLTCLGLVVFNWKLHQGKANEHTSENLCCRTFDEPLCAHEARNYHTKGYCNCHLTQ
ENEIKVMSTVGSRKEMPLLQENSHQATSASESATLDGSFRNLKKKDRGVGSTLFCQDGRL
LHSECSEPPGNMRAFNEAGLLTTYNPRKVQKLWNLEPGEVQPQTLQHHIIRTEDISSDIF
RRRYATPASALAGESLEKRLTNESWQPPIEKEDNGLHPHRQRHFITSSSSKPCEPEEHYV
QKIVQKNRSKYDDPCGLLKQSKPRYFQPNNSLICKYVPCEQFEDYMKEKKPNRRQHSKPE
KEQIQINSAIEKFLMSEDNIDLSGLSTKTKKAYSPKRVIFHDPDLVEINRSMMSPKISTP
WKRQKNQSNQLTKLDVKKFSNTGERNKGEKWFTNSWVLKRKRTPQSDLKGKIKGQNLKLN
LHPFRKVRVHPEKSLSSLPKQCKQVLLPPKKLSKTSETEAKINTVCSADFLQQSESSNYV
RLTSKRLPLKHDSKQTPYYQRNTKRAPLLSANNLRVVNQSSIESSCYSAGHIPDGNTSKL
PQPTPTDAEHRHSHSQFSTEQMEDATQLESKVLSYLATTWENTGSDVLPFQHSRRATDQG
TTESTEHMGQNVSKTSELNQFSLSPRNQTQLLDAHKTDSYNKEYTLDQNEALQHREQNSS
HAQLENKEKTLMTKPQISHQIVENCIMDKEENDVEKKLSKTETYDSSLIPQTQSKNNLSF
MKTNSIPYQNRIELPKDISTSPVSSQAVWHLTNSSEKGIDSTNALPRNDGTEALEIKIVG
KEEKNMLDESKTDSSMLTQISQMTLKGITKERQQTWENGTSEKYILHDASSAEETITAKD
LSITSSHETQNRILCSEVDPEVNSNVHNFREVQNIQPDKDSAHKEGAMTVETHEALSFLP
GLKDSFEAENEVFLVPSRINEAENSAPKPVLYPPSAEYATTSPLETE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70587	0.123	0.106	3.324E-12	1490	0.148	0.124	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
2	AFDB:Q96NW7	0.105	0.090	7.359E-11	1537	0.147	0.119	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
3	AFDB:Q80TH2	0.137	0.124	1.180E-10	1402	0.152	0.136	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
4	AFDB:Q96RT1	0.129	0.117	3.037E-10	1412	0.148	0.131	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
5	PDB:1xcdA	0.140	0.457	1.649E-9	305	0.049	0.200	1xcdA.pdb.gz
6	PDB:5yq5B	0.151	0.539	1.091E-8	306	0.047	0.193	5yq5B.pdb.gz
7	AFDB:M0R9T2	0.158	0.156	1.641E-8	1258	0.149	0.148	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
8	PDB:6gffI	0.133	0.271	1.750E-8	551	0.055	0.125	6gffI.pdb.gz
9	PDB:7tvfD	0.121	0.264	1.845E-8	515	0.038	0.091	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
10	PDB:2ft3F	0.123	0.398	7.611E-8	305	0.046	0.187	2ft3F.pdb.gz
11	PDB:7wv3A	0.123	0.215	8.910E-8	668	0.044	0.082	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
12	PDB:5y31B	0.103	0.221	1.043E-7	511	0.043	0.104	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
13	PDB:3t6qA	0.145	0.275	1.429E-7	601	0.050	0.103	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	AFDB:E7F5U2	0.167	0.087	2.651E-7	2497	0.155	0.077	E7F5U2.pdb.gz
15	PDB:3b2dA	0.140	0.265	2.828E-7	601	0.046	0.095	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:7p5vB	0.135	0.224	1.107E-6	732	0.040	0.068	7p5vB.pdb.gz
17	AFDB:Q6WRI0	0.164	0.081	1.849E-6	2623	0.183	0.087	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
18	AFDB:Q3V1M1	0.153	0.077	6.185E-6	2594	0.171	0.082	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
19	AFDB:Q6WRH9	0.166	0.083	1.677E-5	2597	0.167	0.080	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
20	AFDB:Q9R0I7	0.038	0.035	1.187E-2	1386	0.083	0.075	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BZR6	3.96e-19	94.4	473	0.063	0.167	RTN4R_HUMAN Reticulon-4 receptor OS=Homo sapiens OX=9606 GN=RTN4R PE=1 SV=1
2	E9QDQ3	4.25e-19	95.9	858	0.066	0.096	E9QDQ3_DANRE Leucine-rich repeat-containing 4.1 OS=Danio rerio OX=7955 GN=lrrc4.1 PE=4 SV=2
3	Q99M75	2.30e-18	92.0	473	0.062	0.163	RTN4R_RAT Reticulon-4 receptor OS=Rattus norvegicus OX=10116 GN=Rtn4r PE=1 SV=2
4	Q99PI8	5.79e-18	90.9	473	0.061	0.161	RTN4R_MOUSE Reticulon-4 receptor OS=Mus musculus OX=10090 GN=Rtn4r PE=1 SV=1
5	Q45R42	4.71e-17	89.0	652	0.064	0.123	LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrc4 PE=1 SV=1
6	Q00P20	5.89e-17	87.8	469	0.062	0.164	Q00P20_DANRE Nyctalopin OS=Danio rerio OX=7955 GN=nyx PE=2 SV=1
7	Q99PH1	7.50e-17	88.2	652	0.064	0.123	LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2
8	Q9HBW1	7.65e-17	88.2	653	0.064	0.123	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
9	Q6WZD3	2.92e-16	85.5	458	0.055	0.151	Q6WZD3_DANRE Nogo receptor homolog 1a OS=Danio rerio OX=7955 GN=ngrh1a PE=2 SV=1
10	A0A0S0WP14	6.50e-16	85.5	811	0.050	0.076	A0A0S0WP14_DROME Capricious, isoform E OS=Drosophila melanogaster OX=7227 GN=caps PE=4 SV=1
11	Q0E8F0	9.56e-16	85.1	780	0.050	0.079	Q0E8F0_DROME Capricious, isoform D OS=Drosophila melanogaster OX=7227 GN=caps PE=4 SV=2
12	Q9Z1P4	1.23e-15	84.7	907	0.055	0.076	LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus OX=10090 GN=Lgr5 PE=1 SV=2
13	P35858	1.65e-15	84.0	605	0.063	0.129	ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens OX=9606 GN=IGFALS PE=1 SV=1
14	A0A0A8K8C7	1.83e-15	84.3	907	0.055	0.076	A0A0A8K8C7_HUMAN G protein-coupled receptor 49 OS=Homo sapiens OX=9606 GN=GPR49 PE=2 SV=1
15	O75473	1.83e-15	84.3	907	0.055	0.076	LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens OX=9606 GN=LGR5 PE=1 SV=1
16	Q6WRI0	1.97e-15	84.7	2623	0.056	0.027	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
17	Q9VU53	2.01e-15	83.2	540	0.050	0.115	Q9VU53_DROME Capricious, isoform A OS=Drosophila melanogaster OX=7227 GN=caps PE=1 SV=3
18	O96671	3.79e-15	82.4	532	0.050	0.117	O96671_DROME CAPRICIOUS OS=Drosophila melanogaster OX=7227 GN=caps PE=2 SV=1
19	P0CC10	9.96e-15	81.6	709	0.061	0.107	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
20	Q6WRH9	1.01e-14	82.4	2597	0.057	0.027	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	20	17.0	Leucine Rich Repeat
2	PF12799 LRR_4	3.7e-08	44.7	Leucine Rich repeats (2 copies)
3	PF13306 LRR_5	0.00044	31.7	BspA type Leucine rich repeat region (6 copies)
4	PF13855 LRR_8	7.5e-24	94.6	Leucine rich repeat
5	PF14580 LRR_9	4.5	18.3	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000011147

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000028733	0.700	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0050794	0.955	regulation of cellular process
GO:0032502	0.803	developmental process
GO:0032501	0.788	multicellular organismal process
GO:0048856	0.731	anatomical structure development
GO:0007275	0.683	multicellular organism development
GO:0048731	0.634	system development
GO:0019222	0.416	regulation of metabolic process
GO:0030154	0.386	cell differentiation
GO:0007399	0.372	nervous system development
GO:0048518	0.363	positive regulation of biological process
GO:0060255	0.361	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0071944	0.736	cell periphery
GO:0005622	0.731	intracellular anatomical structure
GO:0005886	0.727	plasma membrane
GO:0043226	0.610	organelle
GO:0043227	0.455	membrane-bounded organelle
GO:0043229	0.424	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]