StarFunc result for job id A6NMB1

User Input

>input (481 residues)
MLLLPLLLPVLGAGSLNKDPSYSLQVQRQVPVPEGLCVIVSCNLSYPRDGWDESTAAYGY
WFKGRTSPKTGAPVATNNQSREVAMSTRDRFQLTGDPGKGSCSLVIRDAQREDEAWYFFR
VERGSRVRHSFLSNAFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFKKCPAPSFS
WTGAALSPRRTRPSTSHFSVLSFTPSPQDHDTDLTCHVDFSRKGVSAQRTVRLRVASLEL
QGNVIYLEVQKGQFLRLLCAADSQPPATLSWVLQDRVLSSSHPWGPRTLGLELPGVKAGD
SGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLRNGTSLRVLEGQSLR
LVCVTHSSPPARLSWTWGEQTVGPSQPSDPGVLQLPRVQMEHEGEFTCHARHPLGSQRVS
LSFSVHCKSGPMTGVVLVAVGEVAMKILLLCLCLILLRVRSCRRKAARAALGMEAADAVT
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NMB1	1.000	1.000	8.898E-90	481	1.000	1.000	A6NMB1.pdb.gz	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
2	AFDB:Q96RL6	0.648	0.472	2.435E-70	698	0.848	0.585	Q96RL6.pdb.gz	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
3	AFDB:Q96LC7	0.592	0.433	9.948E-64	697	0.717	0.495	Q96LC7.pdb.gz	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
4	AFDB:Q80ZE3	0.670	0.490	9.999E-51	688	0.541	0.378	Q80ZE3.pdb.gz	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
5	AFDB:Q96PQ1	0.352	0.293	2.381E-37	595	0.383	0.309	Q96PQ1.pdb.gz	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
6	AFDB:Q9NYZ4	0.412	0.398	1.208E-36	499	0.370	0.357	Q9NYZ4.pdb.gz	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
7	AFDB:O15389	0.544	0.487	5.430E-35	551	0.391	0.341	O15389.pdb.gz	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
8	AFDB:Q9Y286	0.410	0.422	5.713E-35	467	0.372	0.383	Q9Y286.pdb.gz	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
9	AFDB:Q91Y57	0.405	0.416	7.746E-35	467	0.328	0.338	Q91Y57.pdb.gz	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
10	AFDB:Q920G3	0.638	0.549	3.374E-34	569	0.308	0.260	Q920G3.pdb.gz	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
11	PDB:5oj2B	0.277	0.207	1.544E-15	692	0.152	0.105	5oj2B.pdb.gz
12	PDB:1e07A	0.308	0.255	1.915E-13	642	0.148	0.111	1e07A.pdb.gz
13	PDB:6dldD	0.308	0.503	2.680E-12	269	0.112	0.201	6dldD.pdb.gz
14	PDB:1hzhH	0.175	0.183	4.367E-11	457	0.143	0.151	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
15	PDB:6dlfA	0.315	0.571	1.205E-10	236	0.112	0.229	6dlfA.pdb.gz
16	PDB:1igtB	0.200	0.215	1.476E-10	444	0.162	0.176	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
17	PDB:1igaA	0.175	0.177	2.286E-9	475	0.152	0.154	1igaA.pdb.gz
18	PDB:1zvoC	0.185	0.175	8.553E-9	512	0.168	0.158	1zvoC.pdb.gz
19	PDB:7q1yA	0.172	0.083	1.421E-8	1374	0.106	0.037	7q1yA.pdb.gz
20	PDB:7sqcO0	0.153	0.083	1.495E-8	1140	0.116	0.049	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NMB1	0.0	984	481	1.000	1.000	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
2	Q96LC7	0.0	677	697	0.703	0.485	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
3	Q96RL6	0.0	825	698	0.854	0.589	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
4	Q80ZE3	6.50e-171	499	688	0.541	0.378	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
5	O15389	1.11e-78	257	551	0.378	0.330	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
6	Q96PQ1	1.89e-76	252	595	0.385	0.311	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
7	Q08ET2	9.17e-76	245	396	0.293	0.356	SIG14_HUMAN Sialic acid-binding Ig-like lectin 14 OS=Homo sapiens OX=9606 GN=SIGLEC14 PE=1 SV=1
8	Q9Y286	3.43e-73	240	467	0.297	0.306	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
9	Q9NYZ4	1.75e-70	234	499	0.306	0.295	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
10	Q9Y336	1.10e-68	228	463	0.287	0.298	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
11	Q91Y57	1.04e-65	221	467	0.274	0.283	SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 OS=Mus musculus OX=10090 GN=Siglec12 PE=1 SV=3
12	Q920G3	2.53e-63	217	569	0.337	0.285	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
13	O43699	3.12e-63	214	453	0.277	0.294	SIGL6_HUMAN Sialic acid-binding Ig-like lectin 6 OS=Homo sapiens OX=9606 GN=SIGLEC6 PE=1 SV=2
14	P20138	1.19e-57	196	364	0.212	0.280	CD33_HUMAN Myeloid cell surface antigen CD33 OS=Homo sapiens OX=9606 GN=CD33 PE=1 SV=2
15	Q546G0	1.19e-57	196	364	0.212	0.280	Q546G0_HUMAN CD33 antigen (Gp67) OS=Homo sapiens OX=9606 GN=CD33 PE=4 SV=1
16	Q3Y597	1.34e-44	160	309	0.195	0.304	Q3Y597_MOUSE SIGLEC-H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
17	G3X9N0	1.57e-44	160	293	0.195	0.321	G3X9N0_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=4 SV=1
18	Q4QQK7	1.72e-44	160	309	0.195	0.304	Q4QQK7_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
19	A0A4W8	5.21e-44	158	293	0.193	0.317	A0A4W8_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
20	B7ZMQ6	7.14e-44	159	332	0.195	0.283	B7ZMQ6_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	0.002	29.4	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	1.6e-17	74.6	Immunoglobulin I-set domain
3	PF00047 ig	8.8e-16	69.2	Immunoglobulin domain
4	PF13895 Ig_2	1e-21	88.3	Immunoglobulin domain
5	PF13927 Ig_3	7.5e-22	89.0	Immunoglobulin domain
6	PF07686 V-set	1.8e-17	74.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000019458

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000018632	0.506	TYRO protein tyrosine kinase-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043167	0.376	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0048583	0.969	regulation of response to stimulus
GO:0002831	0.868	regulation of response to biotic stimulus
GO:0031347	0.864	regulation of defense response
GO:0032101	0.827	regulation of response to external stimulus
GO:0019222	0.767	regulation of metabolic process
GO:0001817	0.760	regulation of cytokine production
GO:0048518	0.684	positive regulation of biological process
GO:0048584	0.615	positive regulation of response to stimulus
GO:0051240	0.560	positive regulation of multicellular organismal process
GO:0009987	0.557	cellular process
GO:0032103	0.545	positive regulation of response to external stimulus
GO:0010604	0.490	positive regulation of macromolecule metabolic process
GO:0010628	0.462	positive regulation of gene expression
GO:0002833	0.455	positive regulation of response to biotic stimulus
GO:0031349	0.448	positive regulation of defense response
GO:0001819	0.438	positive regulation of cytokine production
GO:0050794	0.432	regulation of cellular process
GO:1900424	0.370	regulation of defense response to bacterium
GO:0050896	0.350	response to stimulus
GO:0048522	0.304	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.708	intracellular membrane-bounded organelle
GO:0005737	0.504	cytoplasm
GO:0012505	0.462	endomembrane system
GO:0031982	0.381	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]