StarFunc result for job id A6NMS7

User Input

>input (1700 residues)
MSSAQCPALVCVMSRLRFWGPWPLLMWQLLWLLVKEAQPLEWVKDPLQLTSNPLGPPESW
SSHSSHFPRESPHAPTLPADPWDFDHLGPSASSEMPAPPQESTENLVPFLDTWDSAGEQP
LEPEQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWSLAEIIGITRQLSTPQSQKQTL
QNEYSSTDTPYPGSLPPELRVKSDEPPGPSEQVGPSQFHLEPETQNPETLEDIQSSSLQQ
EAPAQLPQLLEEEPSSMQQEAPALPPESSMESLTLPNHEVSVQPPGEDQAYYHLPNITVK
PADVEVTITSEPTNETESSQAQQETPIQFPEEVEPSATQQEAPIEPPVPPMEHELSISEQ
QQPVQPSESPREVESSPTQQETPGQPPEHHEVTVSPPGHHQTHHLASPSVSVKPPDVQLT
IAAEPSAEVGTSLVHQEATTRLSGSGNDVEPPAIQHGGPPLLPESSEEAGPLAVQQETSF
QSPEPINNENPSPTQQEAAAEHPQTAEEGESSLTHQEAPAQTPEFPNVVVAQPPEHSHLT
QATVQPLDLGFTITPESKTEVELSPTMKETPTQPPKKVVPQLRVYQGVTNPTPGQDQAQH
PVSPSVTVQLLDLGLTITPEPTTEVGHSTPPKRTIVSPKHPEVTLPHPDQVQTQHSHLTR
ATVQPLDLGFTITPKSMTEVEPSTALMTTAPPPGHPEVTLPPSDKGQAQHSHLTQATVQP
LDLELTITTKPTTEVKPSPTTEETSTQPPDLGLAIIPEPTTETGHSTALEKTTAPRPDRV
QTLHRSLTEVTGPPTELEPAQDSLVQSESYTQNKALTAPEEHKASTSTNICELCTCGDEM
LSCIDLNPEQRLRQVPVPEPNTHNGTFTILNFQGNYISYIDGNVWKAYSWTEKLILRENN
LTELHKDSFEGLLSLQYLDLSCNKIQSIERHTFEPLPFLKFINLSCNVITELSFGTFQAW
HGMQFLHKLILNHNPLTTVEDPYLFKLPALKYLDMGTTLVPLTTLKNILMMTVELEKLIL
PSHMACCLCQFKNSIEAVCKTVKLHCNSACLTNTTHCPEEASVGNPEGAFMKVLQARKNY
TSTELIVEPEEPSDSSGINLSGFGSEQLDTNDESDFISTLSYILPYFSAVNLDVKSLLLP
FIKLPTTGNSLAKIQTVGQNRQRVKRVLMGPRSIQKRHFKEVGRQSIRREQGAQASVENA
AEEKRLTSPAPREVEQPHTQQGPEKLAGNAVYTKPSFTQEHKAAVSVLKPFSKGTPSTSS
PAKALPQVRDRSKDLTHAISILESAKARVTNTKTSKPIVHARKKYRFHKTRSHVTHRTTK
VKKSPKVRKKSYLSRLMLANRLPFSAAKSLINSPSQGAFSSLGDLSPQENPFLEVSALSE
HFIEKNNTKHTTARNAFEENDFMENTNMPEGTISENTNYNHPPEADSAGTAFNLGPTVKQ
TETKWEYNNVGTDLSPEPKSFNYPLLSSPGDQFEIQLTQQLQSLIPNNNVRRLIAHVIRT
LKMDCSGAHVQVTCAKLISRTGHLMKLLSGQQEVKASKIEWDTDQWKIENYINESTEAQS
EQKEKSLELKKEVPGYGYTDKLILALIVTGILTILIILFCLIVICCHRRSLQEDEEGFSR
GIFRFLPWRGCSSRRESQDGLSSFGQPLWFKDLYKPLSATRINNHAWKLHKKSSNEDKIL
NRDPGDSEAPTEEEESEALP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2ft3F	0.079	0.322	4.489E-7	305	0.027	0.151	2ft3F.pdb.gz
2	PDB:6gffI	0.079	0.204	5.055E-7	551	0.035	0.109	6gffI.pdb.gz
3	PDB:1xcdA	0.096	0.501	6.042E-7	305	0.028	0.154	1xcdA.pdb.gz
4	AFDB:P34288	0.040	0.042	6.476E-7	1605	0.131	0.138	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
5	PDB:7wv3A	0.082	0.193	2.831E-6	668	0.022	0.057	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
6	PDB:6zxdk	0.076	0.287	3.188E-6	430	0.021	0.084	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
7	AFDB:Q95TJ2	0.048	0.061	3.417E-6	1261	0.112	0.151	Q95TJ2.pdb.gz	Q95TJ2_DROME LP06813p OS=Drosophila melanogaster OX=7227 GN=Sdb PE=2 SV=1
8	PDB:5yq5B	0.073	0.270	8.750E-6	306	0.026	0.147	5yq5B.pdb.gz
9	PDB:7tvfD	0.078	0.242	1.110E-5	515	0.026	0.087	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
10	PDB:7wrqA	0.093	0.272	1.250E-5	566	0.025	0.076	7wrqA.pdb.gz
11	PDB:6hkwA	0.078	0.392	2.263E-5	306	0.024	0.134	6hkwA.pdb.gz
12	AFDB:Q5T5U3	0.046	0.042	2.286E-5	1958	0.144	0.125	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
13	AFDB:Q8INM3	0.053	0.059	2.426E-5	1420	0.129	0.155	Q8INM3.pdb.gz	SLE_DROME Protein slender lobes OS=Drosophila melanogaster OX=7227 GN=sle PE=1 SV=1
14	PDB:5xjxC	0.079	0.324	3.233E-5	365	0.023	0.107	5xjxC.pdb.gz
15	AFDB:O76894	0.034	0.033	9.513E-5	1795	0.142	0.135	O76894.pdb.gz	O76894_DROME EG:56G7.1 protein OS=Drosophila melanogaster OX=7227 GN=Mur2B PE=4 SV=2
16	AFDB:H2KYH3	0.036	0.028	1.009E-4	2476	0.133	0.091	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
17	AFDB:Q13428	0.036	0.040	3.514E-4	1488	0.138	0.157	Q13428.pdb.gz	TCOF_HUMAN Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3
18	AFDB:Q9UIF9	0.044	0.042	7.168E-4	1905	0.122	0.109	Q9UIF9.pdb.gz	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
19	AFDB:Q9VRM6	0.036	0.033	1.153E-3	1929	0.123	0.108	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
20	AFDB:Q9Y6X0	0.041	0.042	1.223E-3	1596	0.149	0.159	Q9Y6X0.pdb.gz	SETBP_HUMAN SET-binding protein OS=Homo sapiens OX=9606 GN=SETBP1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80ZD9	1.31e-09	65.1	519	0.037	0.121	AMGO2_MOUSE Amphoterin-induced protein 2 OS=Mus musculus OX=10090 GN=Amigo2 PE=1 SV=1
2	Q8IW52	1.47e-09	65.5	837	0.029	0.060	SLIK4_HUMAN SLIT and NTRK-like protein 4 OS=Homo sapiens OX=9606 GN=SLITRK4 PE=1 SV=1
3	Q810B8	1.67e-09	65.5	837	0.029	0.060	SLIK4_MOUSE SLIT and NTRK-like protein 4 OS=Mus musculus OX=10090 GN=Slitrk4 PE=1 SV=2
4	Q9U3A0	3.08e-09	64.3	594	0.030	0.086	PAN1_CAEEL P-granule-associated novel protein 1 OS=Caenorhabditis elegans OX=6239 GN=pan-1 PE=1 SV=1
5	Q7M6Z0	1.79e-08	61.2	420	0.026	0.107	R4RL2_MOUSE Reticulon-4 receptor-like 2 OS=Mus musculus OX=10090 GN=Rtn4rl2 PE=1 SV=1
6	Q96PE1	1.85e-08	62.0	1338	0.029	0.037	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
7	Q80WD1	2.04e-08	60.8	420	0.026	0.107	R4RL2_RAT Reticulon-4 receptor-like 2 OS=Rattus norvegicus OX=10116 GN=Rtn4rl2 PE=1 SV=1
8	Q810C0	2.21e-08	61.6	846	0.039	0.079	SLIK2_MOUSE SLIT and NTRK-like protein 2 OS=Mus musculus OX=10090 GN=Slitrk2 PE=1 SV=1
9	D3ZK41	2.26e-08	61.6	846	0.039	0.079	D3ZK41_RAT SLIT and NTRK-like family, member 2 OS=Rattus norvegicus OX=10116 GN=Slitrk2 PE=4 SV=2
10	Q3V1M1	2.58e-08	61.6	2594	0.030	0.020	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
11	Q6WRH9	3.01e-08	61.6	2597	0.030	0.020	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
12	Q91ZV8	4.26e-08	60.8	1336	0.025	0.032	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
13	Q9H156	5.75e-08	60.5	845	0.039	0.078	SLIK2_HUMAN SLIT and NTRK-like protein 2 OS=Homo sapiens OX=9606 GN=SLITRK2 PE=1 SV=1
14	Q52KR2	8.50e-08	59.7	1054	0.027	0.044	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
15	Q5U1A7	8.86e-08	59.7	738	0.024	0.054	Q5U1A7_DROME Fish-lips, isoform C OS=Drosophila melanogaster OX=7227 GN=Fili PE=2 SV=1
16	Q7L0X0	3.14e-07	57.8	811	0.030	0.063	TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2
17	Q6P1C6	4.31e-07	57.4	1117	0.027	0.041	LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1
18	Q86UN3	4.41e-07	56.6	420	0.025	0.102	R4RL2_HUMAN Reticulon-4 receptor-like 2 OS=Homo sapiens OX=9606 GN=RTN4RL2 PE=1 SV=1
19	Q6R6I6	4.67e-07	57.4	758	0.031	0.069	RXFP1_RAT Relaxin receptor 1 OS=Rattus norvegicus OX=10116 GN=Rxfp1 PE=2 SV=1
20	B8JKM0	4.82e-07	57.0	524	0.030	0.097	B8JKM0_DANRE Leucine-rich repeat transmembrane neuronal 1 OS=Danio rerio OX=7955 GN=lrrtm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06365 CD34_antigen	6.4	17.9	CD34/Podocalyxin family
2	PF15779 LRRC37	8.4e-89	303.3	Leucine-rich repeat-containing protein 37 family
3	PF14914 LRRC37AB_C	1.3e-68	241.0	LRRC37A/B like protein 1 C-terminal domain
4	PF12799 LRR_4	3e-05	35.5	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	14	17.1	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	6.3e+02	11.9	Leucine Rich repeat
7	PF13855 LRR_8	3.8e-15	66.7	Leucine rich repeat
8	PF14580 LRR_9	1.5e+02	13.4	Leucine-rich repeat
9	PF05510 Sarcoglycan_2	0.32	21.3	Sarcoglycan alpha/epsilon
10	PF15102 TMEM154	1.2e+02	13.9	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404247	0.713	ADP-ribosylation factor-like protein 17
2	9606.ENSP00000262419	0.702	KAT8 regulatory NSL complex subunit 1
3	9606.ENSP00000485398	0.666	speedy/RINGO cell cycle regulator family member E5
4	9606.ENSP00000337478	0.664	ADP ribosylation factor like GTPase 17A
5	9606.ENSP00000389237	0.593	Neuroblastoma breakpoint family member 4
6	9606.ENSP00000386230	0.561	Putative uncharacterized protein C19orf73
7	9606.ENSP00000308515	0.517	dephospho-CoA kinase domain containing
8	9606.ENSP00000340820	0.508	Microtubule-associated protein tau

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.976	regulation of cellular process
GO:0050896	0.531	response to stimulus
GO:0032501	0.527	multicellular organismal process
GO:0048518	0.424	positive regulation of biological process
GO:0051716	0.357	cellular response to stimulus
GO:0048519	0.319	negative regulation of biological process
GO:0048522	0.317	positive regulation of cellular process
GO:0019222	0.302	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005737	0.991	cytoplasm
GO:0012505	0.980	endomembrane system
GO:0071944	0.917	cell periphery
GO:0016020	0.893	membrane
GO:0005634	0.533	nucleus
GO:0005886	0.526	plasma membrane
GO:0031981	0.500	nuclear lumen
GO:0005794	0.333	Golgi apparatus
GO:0005788	0.326	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]