StarFunc result for job id A6NMT0

User Input

>input (343 residues)
MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPAYLPRSVPT
ASMSPPRQGAPTALTDTGASDLGSPGPGSRRGGSPPTAFSPASETTFLKFGVNAILSSGP
RTETSPALLQSVPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRR
GMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSK
ERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHL
RDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NMT0	1.000	1.000	2.635E-51	343	1.000	1.000	A6NMT0.pdb.gz	DBX1_HUMAN Homeobox protein DBX1 OS=Homo sapiens OX=9606 GN=DBX1 PE=3 SV=2
2	AFDB:Q9PTU0	0.501	0.530	8.819E-30	322	0.612	0.652	Q9PTU0.pdb.gz	DBX1B_DANRE Homeobox protein DBX1-B OS=Danio rerio OX=7955 GN=dbx1b PE=2 SV=1
3	AFDB:Q9PTU1	0.380	0.410	4.155E-28	314	0.580	0.634	Q9PTU1.pdb.gz	DBX1A_DANRE Homeobox protein DBX1-A OS=Danio rerio OX=7955 GN=dbx1a PE=2 SV=1
4	AFDB:Q6ZNG2	0.204	0.207	6.177E-13	339	0.367	0.372	Q6ZNG2.pdb.gz	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
5	AFDB:B8JMG3	0.209	0.203	1.371E-9	356	0.259	0.250	B8JMG3.pdb.gz
6	AFDB:B8JMG4	0.199	0.242	6.574E-9	280	0.265	0.325	B8JMG4.pdb.gz
7	AFDB:Q0P031	0.184	0.183	2.902E-7	344	0.207	0.206	Q0P031.pdb.gz	VSX1_XENLA Visual system homeobox 1 OS=Xenopus laevis OX=8355 GN=vsx1 PE=2 SV=1
8	AFDB:Q9H2Z4	0.187	0.181	2.902E-7	354	0.213	0.206	Q9H2Z4.pdb.gz	NKX24_HUMAN Homeobox protein Nkx-2.4 OS=Homo sapiens OX=9606 GN=NKX2-4 PE=1 SV=3
9	AFDB:Q99626	0.223	0.243	3.768E-7	313	0.210	0.230	Q99626.pdb.gz	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
10	AFDB:Q91V10	0.162	0.153	6.352E-7	363	0.222	0.209	Q91V10.pdb.gz	VSX1_MOUSE Visual system homeobox 1 OS=Mus musculus OX=10090 GN=Vsx1 PE=1 SV=1
11	PDB:4egcA	0.148	0.094	7.183E-3	539	0.050	0.032	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.143	0.610	3.923E-2	73	0.050	0.233	2hi3A.pdb.gz
13	PDB:7fbyA	0.111	0.227	2.970E-1	153	0.029	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.109	0.366	1.096	86	0.047	0.186	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:4ldzA	0.123	0.198	1.170	196	0.035	0.061	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:2cg4A	0.117	0.252	1.849	149	0.012	0.027	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:2cyyA	0.106	0.210	1.849	151	0.032	0.073	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
18	PDB:5nr5A	0.117	0.324	1.973	113	0.035	0.106	5nr5A.pdb.gz
19	PDB:7awtE	0.082	0.163	2.106	156	0.026	0.058	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
20	PDB:3femA	0.103	0.123	2.400	281	0.026	0.032	3femA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NMT0	0.0	682	343	1.000	1.000	DBX1_HUMAN Homeobox protein DBX1 OS=Homo sapiens OX=9606 GN=DBX1 PE=3 SV=2
2	P52950	0.0	558	335	0.878	0.899	DBX1_MOUSE Homeobox protein DBX1 OS=Mus musculus OX=10090 GN=Dbx1 PE=2 SV=1
3	E1BS07	2.13e-146	421	403	0.694	0.591	E1BS07_CHICK Leucine twenty homeobox OS=Gallus gallus OX=9031 GN=LEUTX PE=4 SV=3
4	Q9PTU0	5.71e-126	365	322	0.609	0.649	DBX1B_DANRE Homeobox protein DBX1-B OS=Danio rerio OX=7955 GN=dbx1b PE=2 SV=1
5	Q9PTU1	7.76e-124	360	314	0.574	0.627	DBX1A_DANRE Homeobox protein DBX1-A OS=Danio rerio OX=7955 GN=dbx1a PE=2 SV=1
6	Q9W064	2.62e-52	186	741	0.265	0.123	Q9W064_DROME Dbx OS=Drosophila melanogaster OX=7227 GN=Dbx PE=4 SV=2
7	Q6ZNG2	1.90e-36	136	339	0.373	0.378	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
8	Q6NY96	5.68e-26	107	327	0.262	0.275	Q6NY96_DANRE H2.0-like homeo box 1 (Drosophila) OS=Danio rerio OX=7955 GN=fa28a07 PE=2 SV=1
9	Q61670	1.93e-23	102	476	0.128	0.092	HLX_MOUSE H2.0-like homeobox protein OS=Mus musculus OX=10090 GN=Hlx PE=2 SV=1
10	Q14774	3.22e-23	102	488	0.128	0.090	HLX_HUMAN H2.0-like homeobox protein OS=Homo sapiens OX=9606 GN=HLX PE=1 SV=3
11	Q9ER42	1.51e-20	91.7	254	0.207	0.280	BARX1_MOUSE Homeobox protein BarH-like 1 OS=Mus musculus OX=10090 GN=Barx1 PE=2 SV=1
12	Q503F2	1.19e-17	83.2	248	0.163	0.226	BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio OX=7955 GN=barx1 PE=2 SV=2
13	Q9UMQ3	4.98e-16	79.3	279	0.122	0.151	BARX2_HUMAN Homeobox protein BarH-like 2 OS=Homo sapiens OX=9606 GN=BARX2 PE=1 SV=3
14	O08686	5.09e-16	79.3	283	0.122	0.148	BARX2_MOUSE Homeobox protein BarH-like 2 OS=Mus musculus OX=10090 GN=Barx2 PE=2 SV=2
15	Q3C1V8	2.28e-15	76.6	233	0.120	0.176	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
16	Q810B3	2.36e-15	76.6	232	0.120	0.177	BSH_MOUSE Brain-specific homeobox protein homolog OS=Mus musculus OX=10090 GN=Bsx PE=1 SV=1
17	Q22909	1.77e-14	73.9	237	0.087	0.127	HM30_CAEEL Homeobox protein ceh-30 OS=Caenorhabditis elegans OX=6239 GN=ceh-30 PE=2 SV=2
18	Q8VIB5	3.36e-14	75.1	384	0.120	0.107	BARH2_MOUSE BarH-like 2 homeobox protein OS=Mus musculus OX=10090 GN=Barhl2 PE=2 SV=2
19	Q9NY43	3.44e-14	75.1	387	0.120	0.106	BARH2_HUMAN BarH-like 2 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL2 PE=1 SV=2
20	O88181	4.20e-14	74.7	384	0.120	0.107	BARH2_RAT BarH-like 2 homeobox protein OS=Rattus norvegicus OX=10116 GN=Barhl2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11661 DUF2986	29	16.5	Protein of unknown function (DUF2986)
2	PF05920 Homeobox_KN	47	15.3	Homeobox KN domain
3	PF00046 Homeodomain	1.4e-17	74.6	Homeodomain
4	PF15943 YdaS_antitoxin	5.2e+02	12.1	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436881

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331040	0.721	Oligodendrocyte transcription factor 2
2	9606.ENSP00000381499	0.668	Paired box protein Pax-1
3	9606.ENSP00000317333	0.635	Neurogenin-2
4	9606.ENSP00000297261	0.617	Sonic hedgehog protein
5	9606.ENSP00000377854	0.615	LIM/homeobox protein Lhx6
6	9606.ENSP00000362717	0.610	LIM/homeobox protein Lhx2
7	9606.ENSP00000261731	0.605	LIM/homeobox protein Lhx5
8	9606.ENSP00000230658	0.595	Insulin gene enhancer protein ISL-1
9	9606.ENSP00000331608	0.592	Iroquois-class homeodomain protein IRX-3
10	9606.ENSP00000356708	0.589	Oligodendrocyte transcription factor 3
11	9606.ENSP00000263160	0.574	Vesicular glutamate transporter 2
12	9606.ENSP00000302216	0.571	Protein atonal homolog 1
13	9606.ENSP00000290552	0.568	Iroquois-class homeodomain protein IRX-6
14	9606.ENSP00000358210	0.560	Single-minded homolog 1
15	9606.ENSP00000356357	0.554	LIM/homeobox protein Lhx9
16	9606.ENSP00000378912	0.543	Protein cordon-bleu
17	9606.ENSP00000266744	0.537	Achaete-scute homolog 1
18	9606.ENSP00000374205	0.535	T-box brain protein 1
19	9606.ENSP00000305343	0.526	Transcription factor SOX-14
20	9606.ENSP00000253008	0.525	PR domain zinc finger protein 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.996	sequence-specific DNA binding
GO:1990837	0.970	sequence-specific double-stranded DNA binding
GO:0003700	0.965	DNA-binding transcription factor activity
GO:0000981	0.807	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.755	transcription cis-regulatory region binding
GO:0000977	0.669	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.337	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.995	multicellular organism development
GO:0048731	0.987	system development
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0010468	0.977	regulation of gene expression
GO:0009987	0.976	cellular process
GO:0050794	0.969	regulation of cellular process
GO:0030154	0.962	cell differentiation
GO:0007399	0.921	nervous system development
GO:0048513	0.905	animal organ development
GO:0019219	0.894	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.882	regulation of cellular biosynthetic process
GO:0010556	0.881	regulation of macromolecule biosynthetic process
GO:0051252	0.881	regulation of RNA metabolic process
GO:0045165	0.872	cell fate commitment
GO:0006355	0.863	regulation of DNA-templated transcription
GO:0007417	0.760	central nervous system development
GO:0030182	0.722	neuron differentiation
GO:0007389	0.709	pattern specification process
GO:0060581	0.624	cell fate commitment involved in pattern specification
GO:0006357	0.503	regulation of transcription by RNA polymerase II
GO:0050896	0.326	response to stimulus
GO:0048518	0.315	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.896	intracellular organelle lumen
GO:0031981	0.892	nuclear lumen
GO:0005654	0.435	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]