StarFunc result for job id A6NMZ7

User Input

>input (2263 residues)
MMLLILFLVIICSHISVNQDSGPEYADVVFLVDSSDRLGSKSFPFVKMFITKMISSLPIE
ADKYRVALAQYSDKLHSEFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFS
APANGRDKKQFPPILVVLASSESEDNVEEASKALRKDGVKIISVGVQKASEENLKAMATS
QFHFNLRTVRDLSMFSQNMTHIIKDVIKYKEGAVDDIFVEACQGPSMADVVFLLDMSING
SEENFDYLKGFLEESVSALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLS
PRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGV
TIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSE
RTETLKSGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQY
ADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCH
LVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALK
DIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQ
IGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARP
NIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVEN
FDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKAD
VGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFT
EARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMA
GSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFKKMK
EFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIG
AALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQDEVAQAAEALRHRGIDIYSVGIGDV
DDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICTTAGESNCFVDVVVGFDVSTQEKG
QTLLEGQPWMETYLQDILRAISSLNGVSCEVGTETQVSVAFQVTNAMEKYSPKFEIYSEN
ILNSLKDITVKGPSLLNANLLDSLWDTFQNKSAARGKVVLLFSDGLDDDVEKLEQKSDEL
RKEGLNALITVALDGPADSSDLADLPYIEFGKGFEYRTQLSIGMRELGSRLSKQLVNVAE
RTCCCLFCKCIGGDGTMGDPGPPGKRGPPGFKGSEGYLGEEGIAGERGAPGPVGEQGTKG
CYGTKGPKGNRGLNGQEGEVGENGIDGLNGEQGDNGLPGRKGEKGDEGSQGSPGKRGTPG
DRGAKGLRGDPGAPGVDSSIEGPTGLKGERGRQGRRGWPGPPGTPGSRRKTAAHGRRGHT
GPQGTAGIPGPDGLEGSLGLKGPQGPRGEAGVKGEKGGVGSKGPQGPPGPGGEAGNQGRL
GSQGNKGEPGDLGEKGAVGFPGPRGLQGNDGSPGYGSVGRKGAKGQEGFPGESGPKGEIG
DPGGPGETGLKGARGKMISAGLPGEMGSPGEPGPPGRKGVKGAKGLASFSTCELIQYVRD
RSPGRHGKPECPVHPTELVFALDHSRDVTEQEFERMKEMMAFLVRDIKVRENSCPVGAHI
AILSYNSHARHLVRFSDAYKKSQLLREIETIPYERSSASREIGRAMRFISRNVFKRTLPG
AHTRKIATFFSSGQSADAHSITTAAMEFGALEIIPVVITFSNVPSVRRAFAIDDTGTFQV
IVVPSGADYIPALERLQRCTFCYDVCKPDASCDQARPPPVQSYMDAAFLLDASRNMGSAE
FEDIRAFLGALLDHFEITPEPETSVTGDRVALLSHAPPDFLPNTQKSPVRAEFNLTTYRS
KRLMKRHVHESVKQLNGDAFIGHALQWTLDNVFLSTPNLRRNKVIFVISAGETSHLDGEI
LKKESLRAKCQGYALFVFSLGPIWDDKELEDLASHPLDHHLVQLGRIHKPDHSYGVKFVK
SFINSIRRAINKYPPINLKIKCNRLNSIDPKQPPRPFRSFVPGPLKATLKEDVLQKAKFF
QDKKYLSRVARSGRDDAIQNFMRSTSHTFKNGRMIESAPKQHD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AX52	0.327	0.323	0.000	2309	0.353	0.346	A2AX52.pdb.gz	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2
2	AFDB:A6H584	0.742	0.644	0.000	2640	0.514	0.441	A6H584.pdb.gz	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
3	AFDB:A6NMZ7	1.000	1.000	0.000	2263	1.000	1.000	A6NMZ7.pdb.gz	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
4	AFDB:A8TX70	0.543	0.476	0.000	2615	0.530	0.459	A8TX70.pdb.gz	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
5	AFDB:Q8C6K9	0.709	0.708	0.000	2265	0.830	0.829	Q8C6K9.pdb.gz	CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2
6	PDB:4nehA	0.071	0.144	2.048E-10	1084	0.023	0.049	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
7	PDB:4nenA	0.076	0.153	9.520E-10	1063	0.026	0.055	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
8	PDB:2xwbF	0.074	0.218	1.425E-6	714	0.014	0.045	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
9	PDB:6jp8F	0.075	0.169	3.327E-6	973	0.015	0.036	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
10	PDB:6orbA	0.075	0.051	3.327E-6	3352	0.039	0.027	6orbA.pdb.gz
11	PDB:7ad8D	0.068	0.475	3.699E-6	280	0.011	0.093	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:6gym6	0.069	0.407	6.283E-6	335	0.010	0.069	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
13	PDB:7ena2	0.072	0.381	6.625E-6	385	0.011	0.068	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:1m2vA	0.069	0.208	8.189E-6	705	0.016	0.052	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
15	AFDB:O95487	0.070	0.117	1.104E-5	1268	0.055	0.098	O95487.pdb.gz	SC24B_HUMAN Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B PE=1 SV=2
16	PDB:7zs96	0.069	0.361	2.015E-5	383	0.011	0.065	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
17	AFDB:O95486	0.074	0.141	1.078E-4	1093	0.052	0.107	O95486.pdb.gz	SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A PE=1 SV=2
18	AFDB:E9PYK3	0.072	0.082	2.146E-4	1969	0.043	0.049	E9PYK3.pdb.gz	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
19	AFDB:D3ZW15	0.074	0.121	2.386E-4	1242	0.052	0.094	D3ZW15.pdb.gz	D3ZW15_RAT SEC24 homolog B, COPII coat complex component OS=Rattus norvegicus OX=10116 GN=Sec24b PE=3 SV=2
20	AFDB:Q9M291	0.067	0.133	1.786E-3	1096	0.047	0.098	Q9M291.pdb.gz	SC24B_ARATH Protein transport protein SEC24 B OS=Arabidopsis thaliana OX=3702 GN=SEC24B PE=2 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WS16	0.0	998	2677	0.314	0.265	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
2	A0A287BK35	0.0	1484	2337	0.338	0.327	A0A287BK35_PIG Collagen type VI alpha 5 chain OS=Sus scrofa OX=9823 GN=COL6A5 PE=1 SV=2
3	A0A8I5ZTR6	0.0	1014	3109	0.317	0.231	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
4	A0A8I6ADR1	0.0	994	2708	0.314	0.263	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
5	A0A8I6AHL9	0.0	1015	3316	0.317	0.217	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
6	A2AX52	0.0	1255	2309	0.351	0.344	CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2
7	A6H584	0.0	2222	2640	0.511	0.438	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
8	A6NMZ7	0.0	4652	2263	1.000	1.000	CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens OX=9606 GN=COL6A6 PE=1 SV=2
9	A8TX70	0.0	2276	2615	0.522	0.452	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
10	E9PWQ3	0.0	1022	3284	0.319	0.220	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
11	J3QQ16	0.0	998	2677	0.314	0.265	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
12	O88493	0.0	1006	2657	0.312	0.266	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
13	P12111	0.0	1013	3177	0.317	0.226	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
14	Q8C6K9	0.0	3812	2265	0.830	0.830	CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2
15	Q05504	4.63e-167	542	959	0.155	0.365	Q05504_MOUSE Collagen alpha 3 chain type VI (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
16	Q9Z0I9	1.08e-124	437	1703	0.148	0.197	Q9Z0I9_MOUSE Collagen alpha3(VI) (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
17	D3YWD1	3.58e-124	436	1703	0.148	0.196	D3YWD1_MOUSE Collagen, type VI, alpha 3 (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
18	F5GZK2	2.02e-61	232	956	0.107	0.253	F5GZK2_HUMAN Collagen type XXI alpha 1 chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=1 SV=2
19	A0A158RFW1	1.90e-59	226	957	0.106	0.251	A0A158RFW1_HUMAN Alpha 1 type XXI collagen OS=Homo sapiens OX=9606 GN=COL21A1 PE=4 SV=1
20	Q96P44	1.90e-59	226	957	0.106	0.251	COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	2.3e-39	144.3	Collagen triple helix repeat (20 copies)
2	PF06707 DUF1194	1.6	19.5	Protein of unknown function (DUF1194)
3	PF00362 Integrin_beta	9.8	17.4	Integrin beta chain VWA domain
4	PF17930 LpxI_N	44	15.4	LpxI N-terminal domain
5	PF02585 PIG-L	6.2e+02	12.4	GlcNAc-PI de-N-acetylase
6	PF04055 Radical_SAM	0.0015	30.5	Radical SAM superfamily
7	PF05036 SPOR	24	16.7	SPOR domain
8	PF00092 VWA	9.7e-272	903.7	von Willebrand factor type A domain
9	PF13519 VWA_2	7.5e-90	308.2	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351310

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355180	0.961	Collagen alpha-1(VI) chain
2	9606.ENSP00000300527	0.939	Collagen alpha-2(VI) chain
3	9606.ENSP00000401749	0.925	Prolyl 4-hydroxylase subunit alpha-3
4	9606.ENSP00000295550	0.916	Collagen alpha-3(VI) chain
5	9606.ENSP00000296585	0.910	Integrin alpha-2
6	9606.ENSP00000265379	0.908	Collagen alpha-5(VI) chain
7	9606.ENSP00000379350	0.908	Integrin beta-1
8	9606.ENSP00000263556	0.907	Prolyl 4-hydroxylase subunit alpha-1
9	9606.ENSP00000282588	0.907	Integrin alpha-1
10	9606.ENSP00000384999	0.907	Prolyl 4-hydroxylase subunit alpha-2
11	9606.ENSP00000452786	0.907	Integrin beta-3
12	9606.ENSP00000261023	0.902	Integrin alpha-V
13	9606.ENSP00000351273	0.901	Caspase-8
14	9606.ENSP00000370542	0.900	Syndecan-1
15	9606.ENSP00000264741	0.701	Integrin alpha-9
16	9606.ENSP00000196061	0.698	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
17	9606.ENSP00000282903	0.688	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
18	9606.ENSP00000367316	0.675	Integrin alpha-8
19	9606.ENSP00000327290	0.667	Integrin alpha-11
20	9606.ENSP00000222573	0.665	Integrin beta-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	1.000	extracellular matrix structural constituent conferring tensile strength
GO:0044877	0.315	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.999	anatomical structure development
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.990	cellular process
GO:0007275	0.975	multicellular organism development
GO:0048731	0.883	system development
GO:0048513	0.868	animal organ development
GO:0065007	0.769	biological regulation
GO:0030154	0.742	cell differentiation
GO:0050789	0.561	regulation of biological process
GO:0009653	0.542	anatomical structure morphogenesis
GO:0050896	0.431	response to stimulus
GO:0071840	0.401	cellular component organization or biogenesis
GO:0050794	0.397	regulation of cellular process
GO:0009888	0.368	tissue development
GO:0016043	0.355	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0043226	0.559	organelle
GO:0012505	0.442	endomembrane system
GO:0070013	0.428	intracellular organelle lumen
GO:0043231	0.390	intracellular membrane-bounded organelle
GO:0005737	0.384	cytoplasm
GO:0016020	0.322	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]