StarFunc result for job id A6NN14

User Input

>input (1252 residues)
MPGAPGSLEMGPLTFRDVTIEFSLEEWQCLDTVQQNLYRDVMLENYRNLVFLGMAVFKPD
LITCLKQGKEPWNMKRHEMVTKPPVMRSHFTQDLWPDQSTKDSFQEVILRTYARCGHKNL
RLRKDCKSANEGKMHKEGYNKLNQCRTATQRKIFQCNKHMKVFHKYSNRNKVRHTKKKTF
KCIKCSKSFFMLSCLIRHKRIHIRQNIYKCEERGKAFKSFSTLTKHKIIHTEDKPYKYKK
CGNAFKFSSTFTKHKRIHTGETPFRCEECGKAFNQSSNLTDHKRIHTGEKTYKCEECGKA
FKGSSNFNAHKVIHTAEKPYKCEDCGKTFNHFSALRKHKIIHTGKKPYKREECGKAFSQS
STLRKHEIIHTGEKPYKCEECGKAFKWSSKLTVHKVVHTGEKPYKCEECGKAFSQFSTLK
KHKIIHTGKKPYKCEECGKAFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKA
IHTGEKPYKCEECGKAFNHFSDLRRHKIIHTGKKPYKCEECGKAFSQSSTLRNHQIIHTG
EKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTREKLY
KCEECGKAFNNSSILAKHKIIHTGKKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEE
CGKAFSHFSALRRHKIIHTGKKPYKCEECGKAFSHFSALRRHKIIHTGEKPYKCEECGKA
FKWSSKLTVHKVIHTAEKPCKCEECGKSFKHFSALRKHKVIHTREKLYKCEECVKAFNSF
SALMKHKVIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALR
KHKVIHTGKKPYKCEECGKAFSQSSSLRKHEIIHSGEKPYKCEECGKAFKWLSKLTVHKV
IHTAEKPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNDSSTLMKHKIIHTG
KKPYKCAECGKAFKQSSHLTRHKAIHTGEKPYKCEECGKDFNNSSTLKKHKLIHTREKLY
KCEECVKAFNNFSALMKHKIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGEKPCKCEE
CDKAFKHFSALRKHKVIHTGKKPYQCDECGKAFNNSSTLTKHKIIHTGEKPYKCEECGKA
FSQSSILTKHKIIHSVEKPYKCEECGKAFNQSSHLTRHKTIHTGEKPYKCEECGKAFIQC
SYLIRHKTIHTREKPTNVKKVPKLLSNPHTLLDKTIHTGEKPYKCEECAKAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05481	0.436	0.452	0.000	1191	0.650	0.683	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
2	AFDB:Q9UII5	0.273	0.398	7.778E-75	783	0.415	0.664	Q9UII5.pdb.gz	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
3	AFDB:P17038	0.213	0.304	1.498E-74	809	0.442	0.685	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	AFDB:Q5DTF8	0.310	0.397	2.145E-72	919	0.372	0.507	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
5	AFDB:Q14587	0.256	0.310	1.046E-70	947	0.329	0.435	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
6	AFDB:A0A1B0GR71	0.249	0.301	8.212E-70	966	0.331	0.430	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
7	AFDB:A6NNF4	0.180	0.248	1.375E-69	738	0.406	0.688	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
8	AFDB:Q9P2J8	0.161	0.209	2.046E-66	865	0.328	0.475	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
9	AFDB:Q5TYW1	0.224	0.253	3.881E-64	1059	0.351	0.415	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
10	AFDB:Q6ZR52	0.221	0.369	6.496E-64	646	0.349	0.676	Q6ZR52.pdb.gz	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
11	PDB:3w5kB	0.048	0.247	9.595E-3	110	0.032	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7dkhI	0.053	0.068	4.066E-1	914	0.065	0.090	7dkhI.pdb.gz
13	PDB:5ijnC	0.074	0.109	4.261E-1	636	0.062	0.123	5ijnC.pdb.gz
14	PDB:7k1kA	0.082	0.049	1.251	3604	0.104	0.036	7k1kA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
15	PDB:5lcwN	0.069	0.104	1.311	703	0.058	0.104	5lcwN.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
16	PDB:7ns4b	0.038	0.091	1.374	340	0.040	0.147	7ns4b.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
17	PDB:6ydhA	0.021	0.232	1.509	62	0.013	0.258	6ydhA.pdb.gz
18	PDB:7o4i1	0.044	0.064	1.509	522	0.044	0.105	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:7wooZ	0.077	0.101	1.736	746	0.062	0.103	7wooZ.pdb.gz
20	PDB:7k0yA	0.079	0.046	1.907	3669	0.092	0.031	7k0yA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WSF4	555	635	0.234	0.461	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
2	A0A0U1RQ46	556	609	0.236	0.484	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
3	A0A1B0GR71	658	966	0.324	0.420	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
4	A0A8I6G8Y2	553	723	0.224	0.389	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
5	A6NNF4	570	616	0.251	0.510	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
6	A8K8Y5	553	707	0.226	0.400	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
7	E9Q981	555	636	0.234	0.461	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
8	F8WEC7	560	859	0.248	0.362	F8WEC7_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
9	G3V9G6	553	740	0.224	0.380	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
10	O75290	595	641	0.251	0.490	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
11	O75437	569	659	0.250	0.475	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
12	P15620	546	580	0.223	0.481	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
13	P17020	551	682	0.222	0.408	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
14	P17038	1013	809	0.435	0.674	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
15	P35789	575	620	0.246	0.497	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
16	P51523	553	738	0.261	0.443	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
17	P52742	568	658	0.248	0.471	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
18	Q02386	550	682	0.232	0.427	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
19	Q03923	553	595	0.239	0.503	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
20	Q03936	546	586	0.238	0.509	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	2e+02	13.3	Rad4 beta-hairpin domain 1
2	PF00130 C1_1	3.3e-06	38.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF07975 C1_4	8.3e+02	11.7	TFIIH C1-like domain
4	PF10976 DUF2790	0.089	24.1	Protein of unknown function (DUF2790)
5	PF01352 KRAB	4.3e-19	79.2	KRAB box
6	PF16919 PknG_rubred	59	15.3	Protein kinase G rubredoxin domain
7	PF01286 XPA_N	1.1e-25	100.6	XPA protein N-terminal
8	PF00096 zf-C2H2	3e-156	510.9	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	4.2e-16	69.7	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	1e-72	245.4	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	1.7e-44	160.2	C2H2-type zinc finger
12	PF15909 zf-C2H2_8	4	19.2	C2H2-type zinc ribbon
13	PF12171 zf-C2H2_jaz	1.2e-22	90.8	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	9.5e-266	859.2	Zinc-finger double domain
15	PF02591 zf-RING_7	59	15.3	C4-type zinc ribbon domain
16	PF18439 zf_UBZ	3.8e-16	69.7	Ubiquitin-Binding Zinc Finger
17	PF09723 Zn-ribbon_8	7.4e-24	94.9	Zinc ribbon domain
18	PF17283 Zn_ribbon_SprT	96	14.4	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380315

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378161	0.803	Acylphosphatase-2
2	9606.ENSP00000224950	0.690	CST complex subunit STN1
3	9606.ENSP00000353332	0.681	Regulator of telomere elongation helicase 1
4	9606.ENSP00000313759	0.615	CST complex subunit CTC1
5	9606.ENSP00000258169	0.608	M-phase phosphoprotein 6
6	9606.ENSP00000351147	0.563	DDB1- and CUL4-associated factor 4
7	9606.ENSP00000274054	0.523	H/ACA ribonucleoprotein complex non-core subunit NAF1
8	9606.ENSP00000309572	0.506	Telomerase reverse transcriptase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.784	transcription regulator activity
GO:0097159	0.506	organic cyclic compound binding
GO:1901363	0.505	heterocyclic compound binding
GO:0003676	0.459	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0010556	0.946	regulation of macromolecule biosynthetic process
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:0045934	0.942	negative regulation of nucleobase-containing compound metabolic process
GO:2001141	0.928	regulation of RNA biosynthetic process
GO:0010468	0.927	regulation of gene expression
GO:0006355	0.880	regulation of DNA-templated transcription
GO:0045892	0.858	negative regulation of DNA-templated transcription
GO:0009987	0.505	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.965	nuclear lumen
GO:0005654	0.891	nucleoplasm
GO:0032991	0.392	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]