StarFunc result for job id A6NNA2

User Input

>input (597 residues)
MSSTVNNGAASMQSTPDAANGFPQPSSSSGTWPRAEEELRAAEPGLVKRAHREILDHERK
RRVELKCMELQEMMEEQGYSEEEIRQKVGTFRQMLMEKEGVLTREDRPGGHIVAETPRLT
EGAEPGLEYAPFDDDDGPVDCDCPASCYRGHRGYRTKHWSSSSASPPPKKKKKKKGGHRR
SRKKRRLESECSCGSSSPLRKKKKSVKKHRRDRSDSGSRRKRRHRSRSSKCKRKEKNKEK
KRPHTESPGRRSHRHSSGSSHSPSLSSHYSDSRSPSRLSPKHRDEGRKTGSQRSSGSRSP
SPSGGSGWGSPQRNGGSGQRSGAHGGRPGSAHSPPDKPSSPSPRVRDKAAAAAPTPPARG
KESPSPRSAPSSQGRGGRAAGGAGRRRRRRRRRRRSRSSASAPRRRGRRRPRPAPPRGSS
RSLSRARSSSDSGSGRGAPGPGPEPGSERGHGGHGKRAKERPPRARPASTSPSPGAHGRR
GGPEGKSSSRSPGPHPRSWSSSRSPSKSRSRSAEKRPHSPSRSPSPKKPLSRDKDGEGRA
RHSEAEATRARRRSRSYSPIRKRRRDSPSFMEPRRITSAASVLFHTTGPAPLPPPAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I3L4D8	0.101	0.061	2.072E-3	1018	0.300	0.176	I3L4D8.pdb.gz	I3L4D8_HUMAN Serine/arginine repetitive matrix 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=1
2	PDB:7w59U	0.072	0.559	2.421E-3	72	0.054	0.444	7w59U.pdb.gz	Mechanism of exon ligation by human spliceosome.
3	AFDB:A7MD48	0.055	0.054	4.642E-2	611	0.245	0.239	A7MD48.pdb.gz	SRRM4_HUMAN Serine/arginine repetitive matrix protein 4 OS=Homo sapiens OX=9606 GN=SRRM4 PE=1 SV=2
4	AFDB:Q55F37	0.090	0.053	2.054E-1	1048	0.102	0.058	Q55F37.pdb.gz	SRFC_DICDI Transcription factor mef2A OS=Dictyostelium discoideum OX=44689 GN=mef2A PE=2 SV=2
5	AFDB:Q70HU3	0.060	0.035	2.197E-1	1135	0.191	0.100	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
6	AFDB:Q8IVE3	0.071	0.034	2.879E-1	1493	0.147	0.059	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
7	AFDB:Q9VZZ9	0.066	0.052	3.527E-1	878	0.162	0.110	Q9VZZ9.pdb.gz	DOS_DROME Protein daughter of sevenless OS=Drosophila melanogaster OX=7227 GN=dos PE=1 SV=1
8	AFDB:Q8R4U7	0.075	0.047	3.773E-1	1068	0.176	0.098	Q8R4U7.pdb.gz	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
9	AFDB:P32499	0.082	0.070	4.622E-1	720	0.127	0.106	P32499.pdb.gz	NUP2_YEAST Nucleoporin NUP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP2 PE=1 SV=2
10	AFDB:A0A0A0MSI2	0.066	0.050	4.945E-1	830	0.168	0.120	A0A0A0MSI2.pdb.gz	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
11	PDB:6bk8K	0.086	0.561	5.401E-1	82	0.042	0.305	6bk8K.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
12	AFDB:P17429	0.055	0.043	5.661E-1	876	0.162	0.111	P17429.pdb.gz	AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=areA PE=1 SV=2
13	PDB:5mpsR	0.075	0.394	2.735	108	0.035	0.194	5mpsR.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
14	PDB:2h9dD	0.063	0.312	5.026	100	0.015	0.090	2h9dD.pdb.gz	Two Crystal Structures of the Isochorismate Pyruvate Lyase from Pseudomonas aeruginosa.
15	PDB:7fbyA	0.038	0.113	7.047	153	0.018	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:6v8oO	0.058	0.079	8.067	384	0.022	0.034	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
17	PDB:7yp9C	0.070	0.036	8.067	1230	0.013	0.007	7yp9C.pdb.gz	Structural basis for intrinsic transcription termination.
18	PDB:2h9dA	0.063	0.361	8.631	84	0.015	0.107	2h9dA.pdb.gz	Two Crystal Structures of the Isochorismate Pyruvate Lyase from Pseudomonas aeruginosa.
19	PDB:4dhxC	0.051	0.246	9.234	93	0.018	0.118	4dhxC.pdb.gz
20	PDB:5k3jA	0.057	0.052	9.234	662	0.015	0.014	5k3jA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3L4D8	1.44e-18	92.4	1018	0.099	0.058	I3L4D8_HUMAN Serine/arginine repetitive matrix 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=1
2	A0A140VK53	1.66e-17	89.4	2752	0.099	0.021	A0A140VK53_HUMAN Testicular secretory protein Li 53 OS=Homo sapiens OX=9606 PE=2 SV=1
3	Q9UQ35	1.66e-17	89.4	2752	0.099	0.021	SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2
4	A8JNI2	1.47e-12	73.6	1655	0.049	0.018	A8JNI2_DROME Serine-arginine repetitive matrix 2/3/4, isoform F OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2
5	Q9W0B0	2.06e-12	72.8	1107	0.049	0.026	Q9W0B0_DROME Serine-arginine repetitive matrix 2/3/4, isoform C OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2
6	Q7YZ99	2.12e-12	72.8	1062	0.049	0.027	Q7YZ99_DROME Serine-arginine repetitive matrix 2/3/4, isoform A OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=1
7	Q960C4	2.15e-12	72.8	1062	0.049	0.027	Q960C4_DROME SD07741p OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=2 SV=1
8	Q9U213	1.25e-10	66.2	425	0.050	0.071	SRRMH_CAEEL SRRM2 protein homolog rsr-2 OS=Caenorhabditis elegans OX=6239 GN=rsr-2 PE=1 SV=1
9	A7MD48	0.009	41.6	611	0.034	0.033	SRRM4_HUMAN Serine/arginine repetitive matrix protein 4 OS=Homo sapiens OX=9606 GN=SRRM4 PE=1 SV=2
10	P0CB65	0.074	38.5	574	0.039	0.040	SRRM4_DANRE Serine/arginine repetitive matrix protein 4 OS=Danio rerio OX=7955 GN=srrm4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08312 cwf21	3.6e-11	54.3	cwf21 domain
2	PF15230 SRRM_C	2.4e-13	61.7	Serine/arginine repetitive matrix protein C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000033040

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000028975	0.957	CWC27 spliceosome-associated protein homolog
2	9598.ENSPTRP00000011043	0.948	RNA binding motif protein 25
3	9598.ENSPTRP00000000609	0.876	Uncharacterized protein
4	9598.ENSPTRP00000031145	0.868	Uncharacterized protein
5	9598.ENSPTRP00000015790	0.863	Elongation factor Tu GTP binding domain containing 2
6	9598.ENSPTRP00000021713	0.859	CWC22 spliceosome-associated protein homolog
7	9598.ENSPTRP00000046108	0.848	Uncharacterized protein
8	9598.ENSPTRP00000000615	0.844	Uncharacterized protein
9	9598.ENSPTRP00000007399	0.844	BUD13 homolog
10	9598.ENSPTRP00000014195	0.844	Splicing factor 3b, subunit 3, 130kDa
11	9598.ENSPTRP00000011189	0.840	SNW domain containing 1
12	9598.ENSPTRP00000014240	0.840	DEAH (Asp-Glu-Ala-His) box polypeptide 38
13	9598.ENSPTRP00000020959	0.839	Small nuclear ribonucleoprotein 200kDa (U5)
14	9598.ENSPTRP00000026473	0.838	ISY1-RAB43 readthrough
15	9598.ENSPTRP00000052333	0.838	Uncharacterized protein
16	9598.ENSPTRP00000047264	0.835	RNA binding motif protein, X-linked 2
17	9598.ENSPTRP00000033279	0.833	Uncharacterized protein
18	9598.ENSPTRP00000015469	0.823	Pan troglodytes CWC25 spliceosome-associated protein homolog (S. cerevisiae) (CWC25), mRNA
19	9598.ENSPTRP00000021823	0.823	Splicing factor 3b, subunit 1, 155kDa
20	9598.ENSPTRP00000060306	0.820	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.999	RNA binding
GO:0070742	0.935	C2H2 zinc finger domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0071704	0.981	organic substance metabolic process
GO:0043170	0.970	macromolecule metabolic process
GO:0044238	0.964	primary metabolic process
GO:0044237	0.955	cellular metabolic process
GO:0006807	0.951	nitrogen compound metabolic process
GO:0034641	0.908	cellular nitrogen compound metabolic process
GO:1901360	0.905	organic cyclic compound metabolic process
GO:0006139	0.886	nucleobase-containing compound metabolic process
GO:0090304	0.875	nucleic acid metabolic process
GO:0050789	0.862	regulation of biological process
GO:0016070	0.860	RNA metabolic process
GO:0010467	0.859	gene expression
GO:0050794	0.848	regulation of cellular process
GO:0016071	0.785	mRNA metabolic process
GO:0006397	0.776	mRNA processing
GO:0019222	0.702	regulation of metabolic process
GO:0008380	0.593	RNA splicing
GO:0000377	0.582	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0080090	0.570	regulation of primary metabolic process
GO:0000398	0.546	mRNA splicing, via spliceosome
GO:0031323	0.434	regulation of cellular metabolic process
GO:0060255	0.328	regulation of macromolecule metabolic process
GO:0051171	0.311	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.959	nuclear body
GO:0016607	0.740	nuclear speck
GO:0032991	0.378	protein-containing complex
GO:0005737	0.310	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]