StarFunc result for job id A6NNA5

User Input

>input (263 residues)
MFYFHCPPQLEGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDV
FTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSP
PPGDQARSKKEALEAQQSLGRTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLC
SCCVPDPMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKP
APPDGSQEKTSPTKEQSEAEKSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NNA5	0.999	0.999	2.904E-40	263	1.000	1.000	A6NNA5.pdb.gz	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
2	AFDB:O42356	0.271	0.222	1.364E-9	330	0.293	0.233	O42356.pdb.gz	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
3	AFDB:Q9H161	0.272	0.181	1.457E-9	411	0.300	0.192	Q9H161.pdb.gz	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
4	AFDB:O42115	0.272	0.165	1.900E-9	453	0.357	0.208	O42115.pdb.gz	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
5	AFDB:O42357	0.297	0.245	2.169E-9	327	0.281	0.226	O42357.pdb.gz	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
6	AFDB:Q90267	0.271	0.219	2.477E-9	338	0.262	0.204	Q90267.pdb.gz	OTX1A_DANRE Homeobox protein OTX1 A OS=Danio rerio OX=7955 GN=otx1a PE=2 SV=1
7	AFDB:O35602	0.282	0.223	3.688E-9	342	0.300	0.231	O35602.pdb.gz	RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus OX=10090 GN=Rax PE=2 SV=2
8	AFDB:Q7SZN8	0.323	0.287	3.688E-9	299	0.289	0.254	Q7SZN8.pdb.gz	Q7SZN8_DANRE Short stature homeobox 2 OS=Danio rerio OX=7955 GN=zgc:65884 PE=2 SV=1
9	AFDB:Q8JIZ3	0.260	0.244	3.688E-9	281	0.281	0.263	Q8JIZ3.pdb.gz	Q8JIZ3_DANRE Cone-rod homeobox OS=Danio rerio OX=7955 GN=crx PE=2 SV=1
10	AFDB:F1R982	0.270	0.248	4.211E-9	289	0.293	0.266	F1R982.pdb.gz
11	PDB:2hi3A	0.188	0.607	3.630E-3	73	0.084	0.301	2hi3A.pdb.gz
12	PDB:4egcA	0.189	0.092	1.121E-2	539	0.065	0.032	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.151	0.240	4.301E-1	153	0.046	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.163	0.334	6.402E-1	113	0.065	0.150	5nr5A.pdb.gz
15	PDB:7b93E	0.102	0.122	1.328	215	0.030	0.037	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
16	PDB:5aj0BZ	0.139	0.322	1.419	86	0.030	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:5mymC	0.111	0.135	2.112	205	0.030	0.039	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.
18	PDB:4zzlA	0.133	0.211	2.257	146	0.061	0.110	4zzlA.pdb.gz
19	PDB:2rvqC	0.119	0.167	2.412	133	0.065	0.128	2rvqC.pdb.gz
20	PDB:2cjjA	0.181	0.663	2.754	63	0.034	0.143	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNA5	0.0	543	263	1.000	1.000	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
2	Q8BYH0	0.0	523	263	0.958	0.958	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
3	Q96QS3	3.93e-32	125	562	0.365	0.171	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
4	A6YP92	4.20e-32	125	566	0.365	0.170	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
5	O35085	4.72e-32	125	564	0.365	0.170	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
6	Q9H161	6.37e-32	123	411	0.319	0.204	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
7	O35137	1.30e-31	122	399	0.316	0.208	ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus OX=10090 GN=Alx4 PE=1 SV=1
8	O42115	2.03e-31	122	453	0.361	0.210	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
9	O42357	2.42e-30	117	327	0.297	0.239	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
10	Q5I7G4	4.50e-29	113	284	0.224	0.208	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1
11	F1RCT9	7.45e-29	112	280	0.221	0.207	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1
12	Q6NYV4	7.78e-29	112	277	0.221	0.209	Q6NYV4_DANRE Paired mesoderm homeobox protein 2A OS=Danio rerio OX=7955 GN=arix PE=2 SV=1
13	Q06453	1.04e-28	114	408	0.198	0.127	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
14	A0A0G2JYE6	1.36e-28	112	314	0.224	0.188	A0A0G2JYE6_RAT Paired-like homeobox 2b OS=Rattus norvegicus OX=10116 GN=Phox2b PE=4 SV=2
15	O35690	1.36e-28	112	314	0.224	0.188	PHX2B_MOUSE Paired mesoderm homeobox protein 2B OS=Mus musculus OX=10090 GN=Phox2b PE=1 SV=1
16	Q99453	1.36e-28	112	314	0.224	0.188	PHX2B_HUMAN Paired mesoderm homeobox protein 2B OS=Homo sapiens OX=9606 GN=PHOX2B PE=1 SV=2
17	Q21836	3.15e-28	112	362	0.209	0.152	ARXH_CAEEL Homeobox ARX homolog alr-1 OS=Caenorhabditis elegans OX=6239 GN=alr-1 PE=1 SV=1
18	Q8T0V5	3.74e-28	112	357	0.186	0.137	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
19	Q9XZU0	3.90e-28	112	357	0.186	0.137	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
20	Q62066	4.46e-28	110	280	0.190	0.179	PHX2A_MOUSE Paired mesoderm homeobox protein 2A OS=Mus musculus OX=10090 GN=Phox2a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	17	16.7	Homeobox KN domain
2	PF00046 Homeodomain	5.5e-21	85.5	Homeodomain
3	PF03826 OAR	0.0009	30.2	OAR motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363254

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308219	0.825	RGM domain family member B
2	9606.ENSP00000452126	0.819	Repulsive guidance molecule A
3	9606.ENSP00000361868	0.654	Zinc finger matrin-type 1
4	9606.ENSP00000228347	0.648	DNA-directed RNA polymerase III subunit RPC2
5	9606.ENSP00000337014	0.630	Hemojuvelin
6	9606.ENSP00000366413	0.572	POU domain, class 4, transcription factor 1
7	9606.ENSP00000423550	0.558	Involved in repair of DNA damage following UV irradiation, acting either in the absence of ERCC6 or synergistically with ERCC6. Involved in the regulation of gene expression. In the absence of ERCC6, induces the expression of genes characteristic of interferon-like antiviral responses. This response is almost completely suppressed in the presence of ERCC6. In the presence of ERCC6, regulates the expression of genes involved in metabolism regulation, including IGFBP5 and IGFBP7. In vitro binds to PGBD3-related transposable elements, called MER85s
8	9606.ENSP00000380053	0.555	PRD class homeoboxes and pseudogenes
9	9606.ENSP00000308292	0.503	Protein FAM170B
10	9606.ENSP00000253008	0.501	PR domain zinc finger protein 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.986	DNA-binding transcription factor activity
GO:0005515	0.974	protein binding
GO:0000981	0.909	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.461	transcription cis-regulatory region binding
GO:0000977	0.351	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0050789	0.974	regulation of biological process
GO:0032502	0.967	developmental process
GO:0009987	0.965	cellular process
GO:0048856	0.964	anatomical structure development
GO:0032501	0.936	multicellular organismal process
GO:0050794	0.926	regulation of cellular process
GO:0007399	0.917	nervous system development
GO:0048869	0.871	cellular developmental process
GO:0019222	0.778	regulation of metabolic process
GO:0048513	0.771	animal organ development
GO:0060255	0.764	regulation of macromolecule metabolic process
GO:0030154	0.659	cell differentiation
GO:0010468	0.656	regulation of gene expression
GO:0051171	0.586	regulation of nitrogen compound metabolic process
GO:0080090	0.582	regulation of primary metabolic process
GO:0031323	0.555	regulation of cellular metabolic process
GO:0048518	0.549	positive regulation of biological process
GO:0050896	0.500	response to stimulus
GO:0009653	0.498	anatomical structure morphogenesis
GO:0019219	0.498	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.488	regulation of DNA-templated transcription
GO:0048522	0.405	positive regulation of cellular process
GO:0006357	0.403	regulation of transcription by RNA polymerase II
GO:0010604	0.326	positive regulation of macromolecule metabolic process
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.823	intracellular organelle lumen
GO:0031981	0.793	nuclear lumen
GO:0005654	0.438	nucleoplasm
GO:0005737	0.405	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]