StarFunc result for job id A6NND4

User Input

>input (320 residues)
MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSL
HKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFIL
VVMAYDRYVAICHPLHYPVLMNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIY
HCFCDHLAVVQASCSDTTPQTLMGFCIAMVVSFLPLLLVLLSYVHILASVLRISSLEGRA
KAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNR
DVKAAITKIMSQDPGCDRSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NND4	1.000	1.000	1.425E-43	320	1.000	1.000	A6NND4.pdb.gz	O2AT4_HUMAN Olfactory receptor 2AT4 OS=Homo sapiens OX=9606 GN=OR2AT4 PE=1 SV=1
2	AFDB:Q7TQU8	0.894	0.894	3.711E-23	320	0.391	0.391	Q7TQU8.pdb.gz	Q7TQU8_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or7c70 PE=3 SV=1
3	AFDB:Q8NG98	0.897	0.919	9.541E-23	312	0.359	0.369	Q8NG98.pdb.gz	OR7D4_HUMAN Olfactory receptor 7D4 OS=Homo sapiens OX=9606 GN=OR7D4 PE=1 SV=1
4	AFDB:Q9JHB2	0.891	0.921	3.174E-22	309	0.353	0.366	Q9JHB2.pdb.gz	O7A40_MOUSE Olfactory receptor 7A40 OS=Mus musculus OX=10090 GN=Or7a40 PE=3 SV=1
5	AFDB:O14581	0.899	0.930	5.314E-22	309	0.362	0.375	O14581.pdb.gz	OR7AH_HUMAN Olfactory receptor 7A17 OS=Homo sapiens OX=9606 GN=OR7A17 PE=1 SV=1
6	AFDB:Q15619	0.883	0.900	1.012E-21	314	0.366	0.373	Q15619.pdb.gz	OR1C1_HUMAN Olfactory receptor 1C1 OS=Homo sapiens OX=9606 GN=OR1C1 PE=2 SV=4
7	AFDB:Q9GZK7	0.862	0.875	1.056E-21	315	0.378	0.384	Q9GZK7.pdb.gz	O11A1_HUMAN Olfactory receptor 11A1 OS=Homo sapiens OX=9606 GN=OR11A1 PE=2 SV=1
8	AFDB:O76099	0.888	0.888	1.201E-21	320	0.372	0.372	O76099.pdb.gz	OR7C1_HUMAN Olfactory receptor 7C1 OS=Homo sapiens OX=9606 GN=OR7C1 PE=2 SV=1
9	AFDB:Q8NGE3	0.894	0.913	1.254E-21	313	0.350	0.358	Q8NGE3.pdb.gz	O10P1_HUMAN Olfactory receptor 10P1 OS=Homo sapiens OX=9606 GN=OR10P1 PE=2 SV=1
10	AFDB:Q8VEY9	0.892	0.914	1.254E-21	312	0.328	0.337	Q8VEY9.pdb.gz	Q8VEY9_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or7d10 PE=2 SV=1
11	PDB:7wq3R	0.679	0.745	7.458E-9	289	0.184	0.204	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
12	PDB:6g79S	0.666	0.798	8.856E-9	262	0.172	0.210	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
13	PDB:7sqoR	0.656	0.764	8.856E-9	270	0.188	0.222	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
14	PDB:7e32R	0.703	0.783	1.007E-8	285	0.163	0.182	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
15	PDB:7w55R	0.663	0.696	1.615E-8	303	0.169	0.178	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
16	PDB:6iblA	0.638	0.525	2.090E-8	397	0.188	0.151	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
17	PDB:7f61A	0.746	0.789	2.822E-8	301	0.172	0.183	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
18	PDB:3aymA	0.724	0.667	3.652E-8	350	0.188	0.171	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
19	PDB:7e33R	0.676	0.827	5.148E-8	257	0.150	0.187	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
20	PDB:8ef5M	0.676	0.743	6.381E-8	288	0.156	0.174	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NND4	0.0	642	320	1.000	1.000	O2AT4_HUMAN Olfactory receptor 2AT4 OS=Homo sapiens OX=9606 GN=OR2AT4 PE=1 SV=1
2	Q7TQU8	2.93e-75	235	320	0.397	0.397	Q7TQU8_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or7c70 PE=3 SV=1
3	Q8VGL1	4.70e-75	234	312	0.403	0.413	Q8VGL1_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or6ae1 PE=2 SV=1
4	Q9GZK7	1.05e-70	224	315	0.391	0.397	O11A1_HUMAN Olfactory receptor 11A1 OS=Homo sapiens OX=9606 GN=OR11A1 PE=2 SV=1
5	Q8NGT9	3.60e-70	222	310	0.384	0.397	OR2A1_HUMAN Olfactory receptor 2A1/2A42 OS=Homo sapiens OX=9606 GN=OR2A1 PE=3 SV=2
6	Q8VFE3	5.68e-70	222	313	0.391	0.399	Q8VFE3_MOUSE Olfactory receptor 96 OS=Mus musculus OX=10090 GN=Or11a4 PE=2 SV=1
7	O76099	7.14e-70	222	320	0.372	0.372	OR7C1_HUMAN Olfactory receptor 7C1 OS=Homo sapiens OX=9606 GN=OR7C1 PE=2 SV=1
8	A1L3S1	1.02e-69	221	319	0.403	0.404	A1L3S1_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or13c7 PE=2 SV=1
9	A0A8I6A2T4	1.13e-69	221	317	0.381	0.385	A0A8I6A2T4_RAT Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or5v1b PE=3 SV=1
10	Q9JKA6	2.33e-69	220	315	0.372	0.378	Q9JKA6_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or10a4 PE=2 SV=1
11	Q9QZ22	2.38e-69	220	319	0.400	0.401	Q9QZ22_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or13c7 PE=3 SV=1
12	Q7TRM9	2.95e-69	220	315	0.372	0.378	Q7TRM9_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or10a4 PE=3 SV=1
13	A4IF55	3.09e-69	220	318	0.400	0.403	A4IF55_MOUSE Olfactory receptor (Fragment) OS=Mus musculus OX=10090 GN=Or13c7d PE=2 SV=1
14	Q2HJC5	1.96e-68	218	318	0.397	0.399	Q2HJC5_MOUSE Olfactory receptor (Fragment) OS=Mus musculus OX=10090 GN=Or13c7d PE=2 SV=1
15	Q9QZ19	2.13e-68	218	319	0.397	0.398	Q9QZ19_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or13c7d PE=3 SV=1
16	Q15619	2.68e-68	218	314	0.378	0.385	OR1C1_HUMAN Olfactory receptor 1C1 OS=Homo sapiens OX=9606 GN=OR1C1 PE=2 SV=4
17	Q8NG98	4.83e-68	217	312	0.369	0.378	OR7D4_HUMAN Olfactory receptor 7D4 OS=Homo sapiens OX=9606 GN=OR7D4 PE=1 SV=1
18	Q8NGX9	7.49e-68	216	317	0.384	0.388	OR6P1_HUMAN Olfactory receptor 6P1 OS=Homo sapiens OX=9606 GN=OR6P1 PE=3 SV=1
19	Q9QZ20	1.71e-67	216	318	0.381	0.384	Q9QZ20_MOUSE Olfactory receptor OS=Mus musculus OX=10090 GN=Or13c7c PE=2 SV=1
20	Q8VGS3	6.92e-67	214	310	0.369	0.381	O5AR1_MOUSE Olfactory receptor 5AR1 OS=Mus musculus OX=10090 GN=Or5ar1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.3e-22	91.9	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	1.5e-53	194.0	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	18	16.2	Serpentine type 7TM GPCR chemoreceptor Srsx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304846

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334051	0.633	Guanine nucleotide-binding protein G(olf) subunit alpha
2	9606.ENSP00000371594	0.608	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
3	9606.ENSP00000248150	0.600	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
4	9606.ENSP00000309591	0.600	cAMP-dependent protein kinase catalytic subunit alpha
5	9606.ENSP00000312262	0.600	Beta-adrenergic receptor kinase 1
6	9606.ENSP00000317578	0.600	Beta-adrenergic receptor kinase 2
7	9606.ENSP00000359719	0.600	cAMP-dependent protein kinase catalytic subunit beta
8	9606.ENSP00000366488	0.600	cAMP-dependent protein kinase catalytic subunit gamma
9	9606.ENSP00000403701	0.600	Beta-arrestin-2
10	9606.ENSP00000409581	0.600	Beta-arrestin-1
11	9606.ENSP00000481878	0.600	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
12	9606.ENSP00000476499	0.561	Zinc finger and BTB domain-containing protein 8B
13	9606.ENSP00000379368	0.560	Zinc finger protein 35
14	9606.ENSP00000362609	0.543	Zinc finger and BTB domain-containing protein 8A
15	9606.ENSP00000273173	0.535	Solute carrier family 22 member 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0005488	0.993	binding
GO:0005515	0.984	protein binding
GO:0004930	0.909	G protein-coupled receptor activity
GO:0004984	0.325	olfactory receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0070372	0.875	regulation of ERK1 and ERK2 cascade
GO:1902533	0.838	positive regulation of intracellular signal transduction
GO:0043410	0.799	positive regulation of MAPK cascade
GO:0009987	0.797	cellular process
GO:0050896	0.757	response to stimulus
GO:0070374	0.733	positive regulation of ERK1 and ERK2 cascade
GO:0051716	0.538	cellular response to stimulus
GO:0007165	0.506	signal transduction
GO:0032501	0.301	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.872	organelle
GO:0043227	0.859	membrane-bounded organelle
GO:0005622	0.840	intracellular anatomical structure
GO:0043231	0.794	intracellular membrane-bounded organelle
GO:0005737	0.791	cytoplasm
GO:0005829	0.474	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]