StarFunc result for job id A6NNL0

User Input

>input (878 residues)
MEVKGPSGRSFCCESEGQFKSCLKRHTPSLLLPSSWKGNSGSCLMAEALHRTSPTPNSCP
LPLPLCRMSGVLCSRNLFTFKFSLFQLDSGASGEPGHSLGLTLGFSYCGNCQTAVVSAQP
EGMASNGAYPVLGPGVTANPGTSLSVFTALPFTTPAPGPAHGPLLVTAGAPPGGPLVLST
FPSTPLVTEQDGCGPSGAGASNVFVQMRTEVGPVKAAQAQTLVLTQAPLVWQAPGALCGG
VVCPPPLLLAAAPVVPVMAAQVVGGTQACEGGWSQGLPLPPPPPPAAQLPPIVSQGNAGP
WPQGAHGESSLASSQAKAPPDDSCNPRSVYENFRLWQHYKPLARRHLPQSPDTEALSCFL
IPVLRSLARRKPTMTLEEGLWRAMREWQHTSNFDRMIFYEMAEKFLEFEAEEEMQIQKSQ
WMKGPQCLPPPATPRLEPRGPPAPEVVKQPVYLPSKAGPKAPTACLPPPRPQRPVTKARR
PPPRPHRRAETKARLPPPRPQRPAETKVPEEIPPEVVQEYVDIMEELLGPSLGATGEPEK
QREEGKVKQPQEEDWTPPDPGLLSYIDKLCSQKDFVTKVEAVIHPQFLEELLSPDPQMDF
LALSQDLEQEEGLTLAQLVEKRLPPLKEKQHARAAPSRGTARLDSSSSKFAAGQGAERDV
PDPQQGVGMETCPPQMTARDSQGRGRAHTGMARSEDSVVLLGCQDSPGLRAAWPTSPPQD
HRPTCPGVGTKDALDLPGGSPVRESHGLAQGSSEEEELPSLAFLLGSQHKLLPWWLPQSP
VPASGLLSPEKWGPQGTHQSPSAERRGLNLAPSPANKAKKRPLFGSLSPAEKTPYPGPGL
RVSGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQHCSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Y26	0.151	0.124	1.174E-31	1132	0.363	0.282	Q86Y26.pdb.gz	NUTM1_HUMAN NUT family member 1 OS=Homo sapiens OX=9606 GN=NUTM1 PE=1 SV=2
2	AFDB:D6R9G8	0.055	0.056	1.727E-3	858	0.139	0.142	D6R9G8.pdb.gz	D6R9G8_HUMAN Synuclein alpha interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=SNCAIP PE=1 SV=2
3	AFDB:A0A024R1N6	0.074	0.123	1.447E-2	466	0.098	0.185	A0A024R1N6.pdb.gz
4	AFDB:A0A087X1T2	0.057	0.070	6.442E-2	654	0.132	0.177	A0A087X1T2.pdb.gz	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
5	AFDB:Q5T7N3	0.050	0.046	7.227E-2	995	0.136	0.120	Q5T7N3.pdb.gz	KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KANK4 PE=1 SV=1
6	AFDB:P34278	0.051	0.045	8.586E-2	1010	0.103	0.089	P34278.pdb.gz	KNL1_CAEEL Kinetochore null protein 1 OS=Caenorhabditis elegans OX=6239 GN=knl-1 PE=1 SV=3
7	AFDB:Q8CIA7	0.049	0.050	1.144E-1	853	0.134	0.138	Q8CIA7.pdb.gz	Q8CIA7_MOUSE Plekha5 protein OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
8	AFDB:F4J6F6	0.063	0.047	1.212E-1	1296	0.130	0.088	F4J6F6.pdb.gz	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
9	AFDB:A0A2R8YDD6	0.056	0.055	1.919E-1	892	0.166	0.164	A0A2R8YDD6.pdb.gz	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
10	AFDB:P97868	0.048	0.026	2.153E-1	1790	0.169	0.083	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
11	PDB:6b2eB	0.033	0.098	5.528E-1	193	0.016	0.073	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
12	PDB:7vbcI	0.034	0.160	1.308	107	0.013	0.103	7vbcI.pdb.gz	Structure of the human RNA polymerase I elongation complex.
13	PDB:2lrmA	0.054	0.330	1.555	84	0.011	0.119	2lrmA.pdb.gz
14	PDB:7myjD	0.033	0.106	1.647	187	0.017	0.080	7myjD.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	PDB:7o9md	0.052	0.138	1.647	220	0.013	0.050	7o9md.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
16	PDB:1e07A	0.036	0.046	1.744	642	0.008	0.011	1e07A.pdb.gz
17	PDB:1kcsL	0.035	0.115	1.744	214	0.008	0.033	1kcsL.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
18	PDB:2ig7B	0.029	0.063	1.744	342	0.013	0.032	2ig7B.pdb.gz
19	PDB:6xi2A	0.033	0.049	1.744	528	0.013	0.021	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.
20	PDB:3jcfA	0.051	0.122	1.847	349	0.008	0.020	3jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZLH0	0.0	1178	755	0.722	0.840	B7ZLH0_HUMAN FAM22F protein OS=Homo sapiens OX=9606 GN=FAM22F PE=1 SV=1
2	Q86Y26	2.83e-122	399	1132	0.323	0.251	NUTM1_HUMAN NUT family member 1 OS=Homo sapiens OX=9606 GN=NUTM1 PE=1 SV=2
3	Q3URY6	0.23	37.7	854	0.028	0.029	ARMC2_MOUSE Armadillo repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Armc2 PE=2 SV=3
4	Q96T58	9.7	32.3	3664	0.019	0.005	MINT_HUMAN Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12881 NUT	0	1153.7	NUT protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264335	0.772	14-3-3 protein epsilon
2	9606.ENSP00000367705	0.685	BCL-6 corepressor
3	9606.ENSP00000365210	0.663	G2/mitotic-specific cyclin-B3
4	9606.ENSP00000345793	0.656	Zinc finger CCCH domain-containing protein 7B
5	9606.ENSP00000283928	0.532	Juxtaposed with another zinc finger protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0060255	0.993	regulation of macromolecule metabolic process
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0006355	0.956	regulation of DNA-templated transcription
GO:0009987	0.950	cellular process
GO:0048518	0.920	positive regulation of biological process
GO:0048522	0.909	positive regulation of cellular process
GO:0051173	0.844	positive regulation of nitrogen compound metabolic process
GO:0031325	0.844	positive regulation of cellular metabolic process
GO:0010604	0.788	positive regulation of macromolecule metabolic process
GO:0045935	0.783	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.688	negative regulation of biological process
GO:0009892	0.629	negative regulation of metabolic process
GO:0045893	0.580	positive regulation of DNA-templated transcription
GO:0048523	0.579	negative regulation of cellular process
GO:0010605	0.487	negative regulation of macromolecule metabolic process
GO:0031324	0.417	negative regulation of cellular metabolic process
GO:0051172	0.413	negative regulation of nitrogen compound metabolic process
GO:0006357	0.403	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0032991	0.921	protein-containing complex
GO:0016604	0.864	nuclear body
GO:0005737	0.838	cytoplasm
GO:0005829	0.495	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]