StarFunc result for job id A6NNM3

User Input

>input (1639 residues)
MAKDSPSPLGASPKKPGCSSPAAAVLENQRRELEKLRAELEAERAGWRAERRRFAARERQ
LREEAERERRQLADRLRSKWEAQRSRELRQLQEEMQREREAEIRQLLRWKEAEQRQLQQL
LHRERDGVVRQARELQRQLAEELVNRGHCSRPGASEVSAAQCRCRLQEVLAQLRWQTDGE
QAARIRYLQAALEVERQLFLKYILAHFRGHPALSGSPDPQAVHSLEEPLPQTSSGSCHAP
KPACQLGSLDSLSAEVGVRSRSLGLVSSACSSSPDGLLSTHASSLDCFAPACSRSLDSTR
SLPKASKSEERPSSPDTSTPGSRRLSPPPSPLPPPPPPSAHRKLSNPRGGEGSESQPCEV
LTPSPPGLGHHELIKLNWLLAKALWVLARRCYTLQEENKQLRRAGCPYQADEKVKRLKVK
RAELTGLARRLADRARELQETNLRAVSAPIPGESCAGLELCQVFARQRARDLSEQASAPL
AKDKQIEELRQECHLLQARVASGPCSDLHTGRGGPCTQWLNVRDLDRLQRESQREVLRLQ
RQLMLQQGNGGAWPEAGGQSATCEEVRRQMLALERELDQRRRECQELGTQAAPARRRGEE
AETQLQAALLKNAWLAEENGRLQAKTDWVRKVEAENSEVRGHLGRACQERDASGLIAEQL
LQQAARGQDRQQQLQRDPQKALCDLHPSWKEIQALQCRPGHPPEQPWETSQMPESQVKGS
RRPKFHARPEDYAVSQPNRDIQEKREASLEESPVALGESASVPQVSETVPASQPLSKKTS
SQSNSSSEGSMWATVPSSPTLDRDTASEVDDLEPDSVSLALEMGGSAAPAAPKLKIFMAQ
YNYNPFEGPNDHPEGELPLTAGDYIYIFGDMDEDGFYEGELDDGRRGLVPSNFVEQIPDS
YIPGCLPAKSPDLGPSQLPAGQDEALEEDSLLSGKAQGMVDRGLCQMVRVGSKTEVATEI
LDTKTEACQLGLLQSMGKQGLSRPLLGTKGVLRMAPMQLHLQNVTATSANITWVYSSHRH
PHVVYLDDREHALTPAGVSCYTFQGLCPGTHYRVRVEVRLPWDLLQVYWGTMSSTVTFDT
LLAGPPYPPLEVLVERHASPGVLVVSWLPVTIDSAGSSNGVQVTGYAVYADGLKVCEVAD
ATAGSTVLEFSQLQVPLTWQKVSVRTMSLCGESLDSVPAQIPEDFFMCHRWPETPPFSYT
CGDPSTYRVTFPVCPQKLSLAPPSAKASPHNPGSCGEPQAKFLEAFFEEPPRRQSPVSNL
GSEGECPSSGAGSQAQELAEAWEGCRKDLLFQKSPQNHRPPSVSDQPGEKENCYQHMGTS
KSPAPGFIHLRTECGPRKEPCQEKAALERVLRQKQDAQGFTPPQLGASQQYASDFHNVLK
EEQEALCLDLRGTERREERREPEPHSRQGQALGVKRGCQLHEPSSALCPAPSAKVIKMPR
GGPQQLGTGANTPARVFVALSDYNPLVMSANLKAAEEELVFQKRQLLRVWGSQDTHDFYL
SECNRQVGNIPGRLVAEMEVGTEQTDRRWRSPAQGHLPSVAHLEDFQGLTIPQGSSLVLQ
GNSKRLPLWTPKIMIAALDYDPGDGQMGGQGKGRLALRAGDVVMVYGPMDDQGFYYGELG
GHRGLVPAHLLDHMSLHGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3V0F0	0.237	0.241	0.000	1606	0.631	0.644	Q3V0F0.pdb.gz	RIMB3_MOUSE RIMS-binding protein 3 OS=Mus musculus OX=10090 GN=Rimbp3 PE=1 SV=2
2	AFDB:Q9UFD9	0.158	0.158	0.000	1639	0.992	0.992	Q9UFD9.pdb.gz	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
3	AFDB:O95153	0.130	0.119	5.995E-75	1857	0.317	0.279	O95153.pdb.gz	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
4	AFDB:Q9JIR0	0.120	0.108	2.049E-72	1847	0.318	0.282	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
5	AFDB:A0A0R4IP15	0.075	0.084	1.183E-11	1428	0.064	0.074	A0A0R4IP15.pdb.gz	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
6	AFDB:P97603	0.081	0.093	2.040E-11	1377	0.055	0.065	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
7	AFDB:Q9Z2I4	0.076	0.087	1.092E-9	1366	0.073	0.087	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
8	AFDB:Q2EY15	0.077	0.102	1.218E-9	1191	0.046	0.064	Q2EY15.pdb.gz	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
9	AFDB:P48681	0.055	0.055	1.434E-9	1621	0.163	0.165	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
10	AFDB:Q9JIS1	0.054	0.056	7.776E-9	1555	0.115	0.122	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
11	PDB:8dtlA	0.071	0.132	6.087E-8	741	0.021	0.046	8dtlA.pdb.gz
12	PDB:7u7nC	0.074	0.371	1.171E-7	200	0.024	0.195	7u7nC.pdb.gz
13	PDB:7z0lB	0.070	0.217	4.334E-7	370	0.019	0.084	7z0lB.pdb.gz
14	PDB:6pxvA	0.072	0.127	4.833E-7	823	0.020	0.040	6pxvA.pdb.gz
15	PDB:8eyyA	0.075	0.134	6.704E-7	775	0.020	0.041	8eyyA.pdb.gz
16	PDB:2lqnA	0.037	0.181	9.819E-7	303	0.023	0.122	2lqnA.pdb.gz
17	PDB:6pyhD	0.071	0.126	1.081E-5	798	0.016	0.034	6pyhD.pdb.gz
18	PDB:5mj3A	0.068	0.260	1.206E-5	302	0.020	0.109	5mj3A.pdb.gz
19	PDB:2eyzA	0.045	0.182	5.862E-5	304	0.029	0.158	2eyzA.pdb.gz
20	PDB:1griA	0.036	0.256	1.328E-4	211	0.022	0.171	1griA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V0F0	0.0	1816	1606	0.625	0.638	RIMB3_MOUSE RIMS-binding protein 3 OS=Mus musculus OX=10090 GN=Rimbp3 PE=1 SV=2
2	Q9UFD9	0.0	3303	1639	0.993	0.993	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
3	Q9JIR0	7.90e-64	243	1847	0.133	0.118	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
4	O15034	4.69e-57	219	1052	0.090	0.140	RIMB2_HUMAN RIMS-binding protein 2 OS=Homo sapiens OX=9606 GN=RIMBP2 PE=1 SV=3
5	Q7TNF8	5.53e-55	214	1846	0.092	0.082	RIMB1_MOUSE Peripheral-type benzodiazepine receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 SV=2
6	O95153	7.90e-45	181	1857	0.068	0.060	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
7	Q80U40	8.31e-32	138	1072	0.056	0.086	RIMB2_MOUSE RIMS-binding protein 2 OS=Mus musculus OX=10090 GN=Rimbp2 PE=1 SV=3
8	Q9JIR1	7.35e-31	135	1049	0.056	0.087	RIMB2_RAT RIMS-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Rimbp2 PE=1 SV=2
9	A0A0B4JDC9	4.10e-17	90.5	1844	0.038	0.034	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
10	A0A126GUV2	4.48e-17	90.5	1765	0.038	0.035	A0A126GUV2_DROME RIM-binding protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
11	A0A0B4KG12	4.62e-17	90.5	1799	0.038	0.034	A0A0B4KG12_DROME RIM-binding protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
12	Q86BP0	4.65e-17	90.5	1487	0.038	0.042	Q86BP0_DROME RIM-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
13	A0A0B4JCX2	4.83e-17	90.5	1817	0.038	0.034	A0A0B4JCX2_DROME RIM-binding protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
14	E1JIL7	5.46e-17	90.1	1791	0.038	0.035	E1JIL7_DROME RIM-binding protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
15	Q9VF66	5.51e-17	90.1	1748	0.038	0.035	Q9VF66_DROME RIM-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=5
16	A0A0B4KGQ6	5.57e-17	90.1	1763	0.038	0.035	A0A0B4KGQ6_DROME RIM-binding protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
17	Q86BS0	6.67e-17	89.7	1473	0.039	0.043	Q86BS0_DROME RIM-binding protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
18	Q9N415	5.00e-16	87.0	1276	0.043	0.055	Q9N415_CAEEL Variant SH3 domain protein OS=Caenorhabditis elegans OX=6239 GN=rimb-1 PE=1 SV=3
19	A0A0B4LFQ2	0.002	45.1	754	0.021	0.046	A0A0B4LFQ2_DROME Inner centromere protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Incenp PE=1 SV=1
20	Q557J6	0.002	45.4	481	0.016	0.054	DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum OX=44689 GN=abpE-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	4.9	18.9	Fibronectin type III domain
2	PF00018 SH3_1	0.014	26.3	SH3 domain
3	PF07653 SH3_2	1.5e-19	80.9	Variant SH3 domain
4	PF14604 SH3_9	1.8e-14	64.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483386	0.809	RIMS-binding protein 3A
2	9606.ENSP00000390630	0.801	RIMS binding protein 3C
3	9606.ENSP00000333915	0.582	Cilia- and flagella-associated protein 73
4	9606.ENSP00000262231	0.558	Regulating synaptic membrane exocytosis protein 2
5	9606.ENSP00000346839	0.539	Fibronectin type III domain containing
6	9606.ENSP00000357238	0.531	TSSK6-activating co-chaperone protein
7	9606.ENSP00000315035	0.525	Protein phosphatase 1 regulatory subunit 42
8	9606.ENSP00000293845	0.521	Coiled-coil domain-containing protein 42
9	9606.ENSP00000339626	0.520	Solute carrier family 35 member E4
10	9606.ENSP00000421076	0.518	ATP synthase subunit g 2, mitochondrial
11	9606.ENSP00000215770	0.517	D-dopachrome decarboxylase-like protein
12	9606.ENSP00000362680	0.511	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000384376	0.505	Tudor domain containing 15
14	9606.ENSP00000249079	0.504	UPF0193 protein EVG1
15	9606.ENSP00000428417	0.504	Regulating synaptic membrane exocytosis protein 1
16	9606.ENSP00000329318	0.501	Transmembrane protein 121B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0007283	0.985	spermatogenesis
GO:0022412	0.972	cellular process involved in reproduction in multicellular organism
GO:0048869	0.949	cellular developmental process
GO:0030154	0.910	cell differentiation
GO:0048856	0.884	anatomical structure development
GO:0050789	0.796	regulation of biological process
GO:0050794	0.657	regulation of cellular process
GO:0007281	0.637	germ cell development
GO:0048515	0.578	spermatid differentiation
GO:0009566	0.549	fertilization
GO:0071840	0.366	cellular component organization or biogenesis
GO:0016043	0.330	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.999	cytoskeleton
GO:0005634	0.998	nucleus
GO:0005737	0.961	cytoplasm
GO:0015630	0.899	microtubule cytoskeleton
GO:0002177	0.474	manchette
GO:0016020	0.389	membrane
GO:0070013	0.338	intracellular organelle lumen
GO:0031981	0.318	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]