StarFunc result for job id A6NNN8

User Input

>input (435 residues)
MEGQTPGSRGLPEKPHPATAAATLSSMGAVFILMKSALGAGLLNFPWAFSKAGGVVPAFL
VELVSLVFLISGLVILGYAAAVSGQATYQGVVRGLCGPAIGKLCEACFLLNLLMISVAFL
RVIGDQLEKLCDSLLSGTPPAPQPWYADQRFTLPLLSVLVILPLSAPREIAFQKYTSILG
TLAACYLALVITVQYYLWPQGLVRESHPSLSPASWTSVFSVFPTICFGFQCHEAAVSIYC
SMRKRSLSHWALVSVLSLLACCLIYSLTGVYGFLTFGTEVSADVLMSYPGNDMVIIVARV
LFAVSIVTVYPIVLFLGRSVMQDFWRRSCLGGWGPSALADPSGLWVRMPLTILWVTVTLA
MALFMPDLSEIVSIIGGISSFFIFIFPGLCLICAMGVEPIGPRVKCCLEVWGVVSVLVGT
FIFGQSTAAAVWEMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BWH0	0.893	0.841	1.456E-29	463	0.409	0.384	Q8BWH0.pdb.gz	S38A7_MOUSE Sodium-coupled neutral amino acid transporter 7 OS=Mus musculus OX=10090 GN=Slc38a7 PE=1 SV=1
2	AFDB:P39981	0.849	0.772	2.228E-19	480	0.198	0.179	P39981.pdb.gz	AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT2 PE=2 SV=1
3	AFDB:A2VCW5	0.821	0.749	4.413E-19	479	0.214	0.194	A2VCW5.pdb.gz	S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus OX=10116 GN=Slc38a5 PE=1 SV=1
4	AFDB:A0A024R0W3	0.848	0.734	7.689E-19	506	0.223	0.192	A0A024R0W3.pdb.gz
5	AFDB:Q8WUX1	0.810	0.750	7.689E-19	472	0.225	0.208	Q8WUX1.pdb.gz	S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC38A5 PE=1 SV=1
6	AFDB:Q9H2H9	0.842	0.755	1.129E-18	487	0.200	0.179	Q9H2H9.pdb.gz	S38A1_HUMAN Sodium-coupled neutral amino acid symporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1
7	AFDB:Q8CFE6	0.828	0.720	2.436E-18	504	0.218	0.188	Q8CFE6.pdb.gz	S38A2_MOUSE Sodium-coupled neutral amino acid symporter 2 OS=Mus musculus OX=10090 GN=Slc38a2 PE=1 SV=1
8	AFDB:G3UVW3	0.816	0.779	3.017E-18	457	0.193	0.184	G3UVW3.pdb.gz	S38A6_MOUSE Solute carrier family 38 member 6 OS=Mus musculus OX=10090 GN=Slc38a6 PE=1 SV=1
9	AFDB:P40074	0.831	0.808	3.429E-18	448	0.193	0.188	P40074.pdb.gz	AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT6 PE=1 SV=1
10	AFDB:Q8IZM9	0.810	0.775	3.579E-18	456	0.209	0.200	Q8IZM9.pdb.gz	S38A6_HUMAN Solute carrier family 38 member 6 OS=Homo sapiens OX=9606 GN=SLC38A6 PE=1 SV=2
11	PDB:7kgvB	0.678	0.725	1.880E-9	404	0.172	0.186	7kgvB.pdb.gz
12	PDB:7p9uB	0.599	0.577	1.461E-8	455	0.154	0.147	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
13	PDB:7kgvA	0.602	0.711	2.146E-8	361	0.170	0.205	7kgvA.pdb.gz
14	PDB:7dskB	0.633	0.600	3.739E-8	464	0.159	0.149	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
15	PDB:7cmhB	0.601	0.576	6.800E-8	458	0.154	0.146	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
16	PDB:6jmqA	0.632	0.675	2.784E-7	403	0.156	0.169	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
17	PDB:5j4nA	0.659	0.656	4.454E-7	437	0.122	0.121	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
18	PDB:6li9B	0.594	0.569	4.852E-7	458	0.126	0.120	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
19	PDB:7s1xB	0.558	0.319	7.126E-7	871	0.143	0.071	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
20	PDB:4djiA	0.581	0.524	2.679E-6	493	0.159	0.140	4djiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BWH0	8.21e-104	318	463	0.421	0.395	S38A7_MOUSE Sodium-coupled neutral amino acid transporter 7 OS=Mus musculus OX=10090 GN=Slc38a7 PE=1 SV=1
2	Q9NVC3	6.98e-103	315	462	0.411	0.387	S38A7_HUMAN Sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens OX=9606 GN=SLC38A7 PE=1 SV=1
3	Q9JHZ9	6.42e-21	97.1	504	0.260	0.224	S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc38a3 PE=1 SV=1
4	Q9JM15	7.60e-21	96.7	485	0.221	0.198	S38A1_RAT Sodium-coupled neutral amino acid symporter 1 OS=Rattus norvegicus OX=10116 GN=Slc38a1 PE=1 SV=1
5	Q8K2P7	9.40e-21	96.7	485	0.195	0.175	S38A1_MOUSE Sodium-coupled neutral amino acid symporter 1 OS=Mus musculus OX=10090 GN=Slc38a1 PE=1 SV=1
6	O74327	9.57e-21	95.9	420	0.232	0.240	AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=avt5 PE=3 SV=1
7	Q99624	5.57e-20	94.4	504	0.253	0.218	S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC38A3 PE=1 SV=1
8	P39981	1.31e-19	93.2	480	0.182	0.165	AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT2 PE=2 SV=1
9	Q9DCP2	5.93e-19	91.3	505	0.255	0.220	S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc38a3 PE=1 SV=1
10	Q9H2H9	1.07e-18	90.5	487	0.163	0.146	S38A1_HUMAN Sodium-coupled neutral amino acid symporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1
11	Q8IZM9	2.72e-18	89.0	456	0.202	0.193	S38A6_HUMAN Solute carrier family 38 member 6 OS=Homo sapiens OX=9606 GN=SLC38A6 PE=1 SV=2
12	G3UVW3	2.97e-18	89.0	457	0.202	0.193	S38A6_MOUSE Solute carrier family 38 member 6 OS=Mus musculus OX=10090 GN=Slc38a6 PE=1 SV=1
13	Q57Y06	3.70e-18	88.6	471	0.225	0.208	Q57Y06_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.560 PE=4 SV=1
14	Q57WK1	4.09e-18	88.6	471	0.209	0.193	Q57WK1_TRYB2 Amino acid transporter AATP5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28A12.310 PE=4 SV=1
15	Q57V86	9.52e-18	87.4	466	0.248	0.232	Q57V86_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.170 PE=4 SV=1
16	Q57V82	6.08e-17	85.1	467	0.244	0.227	Q57V82_TRYB2 Amino acid transporter 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.130 PE=4 SV=1
17	Q584L8	3.14e-16	82.8	451	0.221	0.213	Q584L8_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.60 PE=4 SV=1
18	Q584M0	3.75e-16	82.4	450	0.223	0.216	Q584M0_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.40 PE=4 SV=1
19	Q9JHE5	9.19e-16	81.6	504	0.253	0.218	S38A2_RAT Sodium-coupled neutral amino acid symporter 2 OS=Rattus norvegicus OX=10116 GN=Slc38a2 PE=1 SV=1
20	D6XEF7	9.84e-16	81.3	484	0.195	0.176	D6XEF7_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.650 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	1.6e-49	180.4	Transmembrane amino acid transporter protein
2	PF03222 Trp_Tyr_perm	0.024	25.3	Tryptophan/tyrosine permease family
3	PF04650 YSIRK_signal	6.3e+02	11.6	YSIRK type signal peptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299709

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362563	0.691	Zinc finger and BTB domain-containing protein 43
2	9606.ENSP00000307449	0.684	N-terminal EF-hand calcium-binding protein 2
3	9606.ENSP00000380074	0.644	Sodium-coupled neutral amino acid transporter 9
4	9606.ENSP00000339435	0.631	Serine racemase
5	9606.ENSP00000359204	0.594	Phospholipid phosphatase-related protein type 4
6	9606.ENSP00000417161	0.574	G-protein coupled receptor 143
7	9606.ENSP00000310661	0.563	cAMP-specific 3',5'-cyclic phosphodiesterase 7B
8	9606.ENSP00000358033	0.549	Decaprenyl-diphosphate synthase subunit 2
9	9606.ENSP00000367459	0.503	Dyslexia-associated protein KIAA0319

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	1.000	salt transmembrane transporter activity
GO:0015179	1.000	L-amino acid transmembrane transporter activity
GO:0015175	1.000	neutral L-amino acid transmembrane transporter activity
GO:0022890	0.997	inorganic cation transmembrane transporter activity
GO:0008324	0.997	monoatomic cation transmembrane transporter activity
GO:0022804	0.995	active transmembrane transporter activity
GO:0015291	0.994	secondary active transmembrane transporter activity
GO:0022853	0.899	active monoatomic ion transmembrane transporter activity
GO:0015293	0.769	symporter activity
GO:0005488	0.768	binding
GO:0005515	0.658	protein binding
GO:0046873	0.592	metal ion transmembrane transporter activity
GO:0015081	0.560	sodium ion transmembrane transporter activity
GO:0015294	0.556	solute:monoatomic cation symporter activity
GO:0015186	0.484	L-glutamine transmembrane transporter activity
GO:0042887	0.398	amide transmembrane transporter activity
GO:0015370	0.343	solute:sodium symporter activity
GO:0005416	0.337	amino acid:monoatomic cation symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.996	transport
GO:0071702	0.989	organic substance transport
GO:0071705	0.986	nitrogen compound transport
GO:0006865	0.981	amino acid transport
GO:0009987	0.863	cellular process
GO:0015804	0.436	neutral amino acid transport
GO:0065007	0.434	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.997	organelle
GO:0043227	0.985	membrane-bounded organelle
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0016020	0.965	membrane
GO:0005886	0.851	plasma membrane
GO:0031090	0.620	organelle membrane
GO:0012505	0.510	endomembrane system
GO:0098588	0.431	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.560	Na(+)(in) = Na(+)(out)

[back to server]