StarFunc result for job id A6NNT2

User Input

>input (1141 residues)
MSFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVI
MPREGDAQPILNPMKRLSNVFDHVVSRLDKLENQLALLQDLPSTAQLLEASQGTARPVQD
LWHLIKLRKMVEGHDEVMAKSMQTLQDLLTDLHALQVTITALRKEVDMLKNMLDKVHPER
MDIFAEDFKIQNWKMVALQREVASLQNKFKTIPKTEDMVLWSGLHDAMFTSEIGSSPLDL
WQSVEQLPEAALAQTTKYLEATRAIQVSEPVQNPQLLQTVWHYEVPELLPEGSSAQAVSL
SRAQEPAQPPALTPESAPGCTTEFAPGPAPGTEPVPGLELGLELEPVPALGPVPGPSVTP
GSLPAPWPVLGPVPAPGAQPPPLGDWPALPRRWPLPQGWPRVGSWPLWDLGVLRPTQPQP
SRAPPPATEFGSLWPRPLQPYQSRQGEALQLAAVQVKGEENDVPSLRGLRERARKDGAPK
DRTRKDGVPKDRGGKDVDPKDRAHKDDVPKDRGGKDVDPKDRAHKDDVPKDRGGKDGDPK
DRVGKDGAPKEAQPKAPQSALHRLKTTAAIAAAAAAAYAAATSSAAQAAKVAAKFVKDAP
ATKMAAIATDTAAAGPLGVFADVLGAGPSRGATESQILGDDSEIYEILSPSYSAASIGPD
PALSQAMVATKQAMSPEDKKRAVKYSMSHIAQIPVKHDSLKEEFAQLSCNLNQRLSYLAN
MGGPSSLGTTVDILQKKIGSLQKSRLKEEELERIWGNQIEMMKDRYITLDKAVENLQIRM
DEFKTLQAQIKRLEMNKVNKSTMEEELREKADRSALAGKASRVDLETVALELNEMIQGIL
FKVTIHEDSWKKAMEELSKDVNTKLVHSDLDPLKKEMEEVWKIVRKLLIEGLRLDPDSAA
GFRRKLFKRVKCISCDRPVEMMTGPQLITIRKAHLLSRLRPASANSCEYLQRQQMREQQW
LQLQDLGIQEDCQQDWGDGPQNATSLKCKSCNLLTLYPYGDPHVIDYDSAEVDILGVDGI
LYKGRVNSQRGAQPLAVAKELAAVKAPSPPSQSLYDRVHSSALFGAICPPLCPRSSACSA
ASGPHLTMPARPPSLPPLLLLPPLIPSLRDPQQAPGSTRLSRAPHIESRVGRKPPEEPAN
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H0J4	0.060	0.044	2.873E-9	1663	0.181	0.124	Q9H0J4.pdb.gz	QRIC2_HUMAN Glutamine-rich protein 2 OS=Homo sapiens OX=9606 GN=QRICH2 PE=1 SV=1
2	AFDB:Q9U9A9	0.078	0.081	6.075E-5	1100	0.121	0.125	Q9U9A9.pdb.gz	Q9U9A9_DROME Tuberous sclerosis gene product-1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1
3	AFDB:Q99550	0.079	0.077	2.497E-4	1183	0.146	0.141	Q99550.pdb.gz	MPP9_HUMAN M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9 PE=1 SV=6
4	AFDB:Q86UU1	0.092	0.079	3.229E-4	1377	0.151	0.125	Q86UU1.pdb.gz	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
5	AFDB:Q9QXY2	0.045	0.043	1.094E-3	1197	0.129	0.123	Q9QXY2.pdb.gz	SRCN1_RAT SRC kinase signaling inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Srcin1 PE=1 SV=1
6	AFDB:Q96GE4	0.091	0.118	1.415E-3	821	0.090	0.125	Q96GE4.pdb.gz	CEP95_HUMAN Centrosomal protein of 95 kDa OS=Homo sapiens OX=9606 GN=CEP95 PE=1 SV=1
7	AFDB:Q86SQ0	0.050	0.046	4.499E-3	1253	0.135	0.123	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
8	AFDB:Q6IE81	0.055	0.070	8.021E-3	842	0.071	0.096	Q6IE81.pdb.gz	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
9	AFDB:E7FH14	0.044	0.044	1.258E-2	1128	0.083	0.084	E7FH14.pdb.gz	E7FH14_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=hdac5 PE=3 SV=2
10	AFDB:G3XAA4	0.061	0.079	1.258E-2	834	0.076	0.104	G3XAA4.pdb.gz	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
11	PDB:3jb9W	0.045	0.081	7.558E-1	426	0.060	0.160	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	PDB:6o9l3	0.056	0.196	4.017	309	0.030	0.110	6o9l3.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
13	PDB:7pntU	0.045	0.194	4.284	174	0.022	0.144	7pntU.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:3jctq	0.032	0.186	4.871	183	0.015	0.093	3jctq.pdb.gz	Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
15	PDB:7ajtUO	0.046	0.095	5.194	493	0.023	0.053	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7lbmr	0.032	0.034	5.539	1034	0.028	0.031	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
17	PDB:7r5jV0	0.036	0.117	8.144	273	0.032	0.132	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:6v8oM	0.044	0.117	8.684	310	0.012	0.045	6v8oM.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
19	PDB:1xq8A	0.033	0.208	9.261	140	0.019	0.157	1xq8A.pdb.gz
20	PDB:5iy6I	0.016	0.113	9.261	125	0.004	0.032	5iy6I.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V2A7	1.95e-25	115	592	0.053	0.101	QRIC2_MOUSE Glutamine-rich protein 2 OS=Mus musculus OX=10090 GN=Qrich2 PE=2 SV=1
2	Q9H0J4	2.24e-23	110	1663	0.054	0.037	QRIC2_HUMAN Glutamine-rich protein 2 OS=Homo sapiens OX=9606 GN=QRICH2 PE=1 SV=1
3	Q93VA8	8.79e-05	48.5	350	0.028	0.091	Q93VA8_ARATH Alba DNA/RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=ALBA1 PE=1 SV=1
4	M9PC48	7.41e-04	46.6	18095	0.046	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	M9PCJ6	0.001	46.2	18641	0.046	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	Q8IKE1	0.002	45.4	3367	0.031	0.010	Q8IKE1_PLAF7 acetyl-CoA carboxylase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1469600 PE=4 SV=2
7	M9PC41	0.003	44.7	22743	0.046	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PB30	0.004	44.3	22949	0.046	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
9	M9PBZ0	0.004	44.3	22830	0.046	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PC45	0.004	44.3	22300	0.046	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PEH5	0.004	44.3	20710	0.046	0.003	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PEI1	0.004	44.3	21657	0.046	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PB31	0.007	43.5	20404	0.046	0.003	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	P58196	0.019	41.2	326	0.024	0.083	PLS4_MOUSE Phospholipid scramblase 4 OS=Mus musculus OX=10090 GN=Plscr4 PE=2 SV=2
15	Q6NVH9	0.37	36.6	250	0.037	0.168	Q6NVH9_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
16	Q5T8P6	0.52	37.0	1007	0.023	0.026	RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3
17	O23144	0.71	36.2	612	0.043	0.080	PPI1_ARATH Proton pump-interactor 1 OS=Arabidopsis thaliana OX=3702 GN=PPI1 PE=1 SV=2
18	A7E2Y1	0.93	36.2	1983	0.040	0.023	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
19	Q12967	1.0	35.8	914	0.024	0.030	GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens OX=9606 GN=RALGDS PE=1 SV=2
20	Q5KSL6	1.5	35.4	1271	0.027	0.024	DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens OX=9606 GN=DGKK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16043 DUF4795	7.3e-45	164.6	Domain of unknown function (DUF4795)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295759	0.720	Beta-galactosidase-1-like protein
2	9606.ENSP00000398798	0.711	Zinc finger protein 142
3	9606.ENSP00000386272	0.702	Putative sodium-coupled neutral amino acid transporter 11
4	9606.ENSP00000340776	0.640	Cilia- and flagella-associated protein 65
5	9606.ENSP00000283474	0.558	UBA-like domain-containing protein 1
6	9606.ENSP00000399664	0.518	Zinc finger protein ZFP69B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.960	biological regulation
GO:0050789	0.919	regulation of biological process
GO:0071840	0.893	cellular component organization or biogenesis
GO:0016043	0.880	cellular component organization
GO:0000003	0.828	reproduction
GO:0060294	0.747	cilium movement involved in cell motility
GO:0030317	0.737	flagellated sperm motility
GO:0050794	0.661	regulation of cellular process
GO:0019222	0.432	regulation of metabolic process
GO:0060255	0.421	regulation of macromolecule metabolic process
GO:0080090	0.319	regulation of primary metabolic process
GO:0044085	0.314	cellular component biogenesis
GO:0051171	0.310	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0005929	0.967	cilium
GO:0005634	0.933	nucleus
GO:0031982	0.569	vesicle
GO:0031514	0.486	motile cilium
GO:0097729	0.484	9+2 motile cilium
GO:0036126	0.434	sperm flagellum
GO:0012505	0.304	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]