StarFunc result for job id A6NNV3

User Input

>input (312 residues)
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLC
GLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPR
KVLAPEPEEIWVVEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRV
SDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSR
IPLVRNRRFQLCRCMNPRARKNRSQIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPE
HWVWARDRARLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DTA3	0.527	0.616	5.058E-26	265	0.619	0.728	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
2	AFDB:A6NLX3	0.522	0.676	1.203E-23	237	0.497	0.654	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
3	AFDB:Q9YGL1	0.416	0.435	1.727E-13	298	0.234	0.245	Q9YGL1.pdb.gz	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
4	AFDB:Q9PU13	0.417	0.435	4.785E-13	299	0.250	0.261	Q9PU13.pdb.gz	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
5	AFDB:A0A384MTT5	0.424	0.423	9.648E-12	313	0.205	0.204	A0A384MTT5.pdb.gz	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
6	AFDB:Q3V0J1	0.118	0.094	1.811E-1	427	0.183	0.133	Q3V0J1.pdb.gz	TM237_MOUSE Transmembrane protein 237 OS=Mus musculus OX=10090 GN=Tmem237 PE=1 SV=1
7	AFDB:Q39070	0.151	0.114	2.016E-1	429	0.131	0.096	Q39070.pdb.gz	CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-2 PE=1 SV=2
8	AFDB:Q22695	0.184	0.166	2.127E-1	356	0.135	0.118	Q22695.pdb.gz	CD5R1_CAEEL Cyclin-dependent kinase 5 activator 1 OS=Caenorhabditis elegans OX=6239 GN=cdka-1 PE=2 SV=2
9	AFDB:Q9XIL5	0.122	0.057	2.368E-1	849	0.131	0.048	Q9XIL5.pdb.gz	PP154_ARATH Pentatricopeptide repeat-containing protein At2g15820, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OTP51 PE=2 SV=3
10	AFDB:Q59XP0	0.113	0.075	2.499E-1	530	0.125	0.074	Q59XP0.pdb.gz	SEC9_CANAL Protein transport protein SEC9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC9 PE=3 SV=2
11	PDB:6gzhB	0.229	0.271	2.570E-1	252	0.054	0.067	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
12	PDB:7kpvB	0.214	0.227	3.741E-1	290	0.077	0.083	7kpvB.pdb.gz
13	PDB:1zp2A	0.259	0.342	9.824E-1	227	0.058	0.079	1zp2A.pdb.gz
14	PDB:3bviF	0.091	0.127	9.824E-1	173	0.058	0.104	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
15	PDB:7kueB	0.166	0.215	1.094	225	0.058	0.080	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
16	PDB:3r2qA	0.092	0.120	1.154	202	0.045	0.069	3r2qA.pdb.gz	Structural and Functional Genomics of YibF, a Glutathione Transferase Homologue from Escherichia coli
17	PDB:6jhoA	0.141	0.192	1.285	200	0.058	0.090	6jhoA.pdb.gz
18	PDB:1sqfA	0.180	0.146	1.430	425	0.051	0.038	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
19	PDB:3vbbB	0.092	0.068	1.772	454	0.048	0.033	3vbbB.pdb.gz
20	PDB:7nsuD	0.098	0.082	1.772	420	0.045	0.033	7nsuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q495Y8	4.78e-177	497	402	0.901	0.699	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
2	P0CI01	5.73e-176	494	402	0.897	0.697	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
3	P0DTA3	9.36e-129	369	265	0.603	0.709	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	A6NLX3	7.13e-90	270	237	0.490	0.646	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	3.32e-81	248	268	0.426	0.496	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9PU13	5.42e-27	109	299	0.253	0.264	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q9YGL1	7.52e-26	106	298	0.221	0.232	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
8	Q5MJ68	2.07e-24	102	293	0.202	0.215	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q5IBH7	5.55e-17	82.0	310	0.202	0.203	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	A0A384MTT5	5.91e-17	82.0	313	0.186	0.185	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
11	Q5MJ70	5.91e-17	82.0	313	0.186	0.185	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
12	Q4R1K5	9.06e-17	81.3	311	0.186	0.186	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
13	Q9FNQ1	4.9	31.6	2157	0.080	0.012	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
14	P03317	8.9	30.8	2513	0.058	0.007	POLN_SINDV Polyprotein P1234 OS=Sindbis virus OX=11034 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	3.9e-55	197.1	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258704

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378699	0.880	Cyclin-dependent kinase 1
2	9606.ENSP00000266970	0.804	Cyclin-dependent kinase 2
3	9606.ENSP00000485271	0.709	annotation not available
4	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
5	9606.ENSP00000392726	0.522	POM121-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0051726	0.973	regulation of cell cycle
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0080090	0.952	regulation of primary metabolic process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0051246	0.938	regulation of protein metabolic process
GO:0048522	0.935	positive regulation of cellular process
GO:0045859	0.873	regulation of protein kinase activity
GO:0009987	0.821	cellular process
GO:0045787	0.620	positive regulation of cell cycle
GO:0008152	0.501	metabolic process
GO:0071704	0.444	organic substance metabolic process
GO:0000079	0.439	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0022414	0.434	reproductive process
GO:0043170	0.414	macromolecule metabolic process
GO:0009893	0.405	positive regulation of metabolic process
GO:0031325	0.388	positive regulation of cellular metabolic process
GO:0044238	0.378	primary metabolic process
GO:0044237	0.372	cellular metabolic process
GO:0006807	0.363	nitrogen compound metabolic process
GO:0022402	0.345	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043233	0.995	organelle lumen
GO:0005737	0.992	cytoplasm
GO:0031981	0.989	nuclear lumen
GO:0005654	0.983	nucleoplasm
GO:0005829	0.931	cytosol
GO:0043232	0.917	intracellular non-membrane-bounded organelle
GO:0016020	0.444	membrane
GO:0005730	0.415	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]