StarFunc result for job id A6NNX1

User Input

>input (92 residues)
METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR
PDNILEFAADYFTDPRLPNKIHMQLIKDKKAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0RAU5	0.497	0.119	2.309E-2	489	0.228	0.043	M0RAU5.pdb.gz	CATIP_RAT Ciliogenesis-associated TTC17-interacting protein OS=Rattus norvegicus OX=10116 GN=Catip PE=1 SV=1
2	AFDB:Q7Z7H3	0.444	0.139	5.283E-2	387	0.239	0.057	Q7Z7H3.pdb.gz	CATIP_HUMAN Ciliogenesis-associated TTC17-interacting protein OS=Homo sapiens OX=9606 GN=CATIP PE=1 SV=1
3	AFDB:Q08CH6	0.490	0.160	7.741E-2	356	0.174	0.045	Q08CH6.pdb.gz	CATIP_DANRE Ciliogenesis-associated TTC17-interacting protein OS=Danio rerio OX=7955 GN=catip PE=1 SV=1
4	AFDB:Q584I5	0.458	0.489	1.771E-1	84	0.141	0.155	Q584I5.pdb.gz	Q584I5_TRYB2 RIIa domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.760 PE=4 SV=1
5	AFDB:Q9I2C8	0.301	0.172	1.752	216	0.109	0.046	Q9I2C8.pdb.gz	Q9I2C8_PSEAE Sensor kinase, EraS OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=eraS PE=4 SV=1
6	PDB:4wa6B	0.325	0.315	1.945	96	0.130	0.125	4wa6B.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
7	PDB:4rtaB	0.347	0.427	2.209	71	0.141	0.183	4rtaB.pdb.gz
8	AFDB:Q38CE7	0.310	0.068	2.736	645	0.174	0.025	Q38CE7.pdb.gz	Q38CE7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7220 PE=4 SV=1
9	AFDB:Q5B1T7	0.231	0.056	3.107	614	0.185	0.028	Q5B1T7.pdb.gz	Q5B1T7_EMENI Nucleoside transporter (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05493 PE=3 SV=1
10	PDB:7n6g6G	0.335	0.075	3.450	476	0.098	0.019	7n6g6G.pdb.gz	Cryo-EM structure of an active central apparatus.
11	AFDB:Q382G8	0.364	0.194	3.529	196	0.141	0.066	Q382G8.pdb.gz	Q382G8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5260 PE=4 SV=1
12	AFDB:Q8AYC6	0.281	0.113	3.529	299	0.163	0.050	Q8AYC6.pdb.gz	Q8AYC6_CHICK Uracil-DNA glycosylase OS=Gallus gallus OX=9031 GN=ung PE=2 SV=1
13	AFDB:Q96M34	0.319	0.061	3.529	536	0.087	0.015	Q96M34.pdb.gz	TEX55_HUMAN Testis-specific expressed protein 55 OS=Homo sapiens OX=9606 GN=TEX55 PE=1 SV=2
14	PDB:4f0tB	0.267	0.172	3.677	172	0.109	0.058	4f0tB.pdb.gz
15	PDB:3j4qB	0.308	0.075	4.176	382	0.098	0.024	3j4qB.pdb.gz
16	PDB:6hrzB	0.255	0.125	4.176	202	0.098	0.045	6hrzB.pdb.gz	A fragment-based approach towards the discovery of N-substituted tropinones as inhibitors of Mycobacterium tuberculosis transcriptional regulator EthR2.
17	PDB:5l4kT	0.192	0.094	5.387	272	0.130	0.044	5l4kT.pdb.gz
18	PDB:6venP	0.330	0.609	5.741	42	0.109	0.238	6venP.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
19	PDB:8ap7N	0.211	0.155	6.520	139	0.120	0.079	8ap7N.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
20	PDB:2ndoA	0.241	0.137	6.949	189	0.065	0.032	2ndoA.pdb.gz	Determination of ligand binding modes in weak protein-ligand complexes using sparse NMR data.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7H3	7.35e-05	41.6	387	0.217	0.052	CATIP_HUMAN Ciliogenesis-associated TTC17-interacting protein OS=Homo sapiens OX=9606 GN=CATIP PE=1 SV=1
2	Q08CH6	0.007	36.2	356	0.141	0.037	CATIP_DANRE Ciliogenesis-associated TTC17-interacting protein OS=Danio rerio OX=7955 GN=catip PE=1 SV=1
3	M0RAU5	0.008	35.8	489	0.239	0.045	CATIP_RAT Ciliogenesis-associated TTC17-interacting protein OS=Rattus norvegicus OX=10116 GN=Catip PE=1 SV=1
4	Q15506	0.14	32.0	151	0.152	0.093	SP17_HUMAN Sperm surface protein Sp17 OS=Homo sapiens OX=9606 GN=SPA17 PE=1 SV=1
5	P36425	0.16	32.0	146	0.152	0.096	SP17_RABIT Sperm surface protein Sp17 OS=Oryctolagus cuniculus OX=9986 GN=SPA17 PE=1 SV=2
6	Q62252	0.16	32.0	149	0.152	0.094	SP17_MOUSE Sperm surface protein Sp17 OS=Mus musculus OX=10090 GN=Spa17 PE=1 SV=1
7	P00515	0.35	31.2	401	0.130	0.030	KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2
8	Q4GYF3	0.55	30.8	789	0.141	0.016	Q4GYF3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4250 PE=4 SV=1
9	A9C3T0	0.66	30.4	397	0.130	0.030	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
10	Q08BH1	0.69	30.4	397	0.130	0.030	Q08BH1_DANRE Prkar2aa protein OS=Danio rerio OX=7955 GN=prkar2aa PE=2 SV=1
11	F1QK17	0.88	30.0	646	0.152	0.022	F1QK17_DANRE Sperm autoantigenic protein 17 OS=Danio rerio OX=7955 GN=spa17 PE=1 SV=1
12	Q05AK7	0.89	30.0	660	0.152	0.021	Q05AK7_DANRE Uncharacterized protein LOC564082 OS=Danio rerio OX=7955 GN=spa17 PE=2 SV=1
13	C1PIG4	1.1	29.6	401	0.120	0.027	C1PIG4_PIG cAMP-dependent protein kinase regulatory subunit type II alpha OS=Sus scrofa OX=9823 GN=PRKAR2A PE=2 SV=1
14	P13861	2.1	28.9	404	0.120	0.027	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
15	Q846V4	2.5	28.9	660	0.163	0.023	Q846V4_STAAU Staphylocoagulase (Fragment) OS=Staphylococcus aureus OX=1280 PE=1 SV=2
16	A9A1T2	4.7	28.1	457	0.141	0.028	MPNS_NITMS Methylphosphonate synthase OS=Nitrosopumilus maritimus (strain SCM1) OX=436308 GN=mpnS PE=1 SV=1
17	Q08058	5.6	27.7	207	0.174	0.077	COQ10_YEAST Coenzyme Q-binding protein COQ10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ10 PE=1 SV=1
18	P12368	6.1	27.7	401	0.109	0.025	KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2a PE=1 SV=4
19	P34284	6.5	27.7	466	0.163	0.032	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
20	Q877K1	6.7	27.3	119	0.152	0.118	Q877K1_PSESM ISPsy5, Orf1 OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=PSPTO_0036 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02197 RIIa	0.032	25.2	Regulatory subunit of type II PKA R-subunit
2	PF12845 TBD	1.3e+02	13.8	TBD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419249

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380880	0.715	PQ-loop repeat-containing protein 1
2	9606.ENSP00000359042	0.712	Pre-mRNA-splicing factor 38B
3	9606.ENSP00000477352	0.687	Short coiled-coil protein
4	9606.ENSP00000431459	0.673	Leucine repeat adapter protein 25
5	9606.ENSP00000362444	0.658	Disks large-associated protein 3
6	9606.ENSP00000315295	0.633	UPF0606 protein KIAA1549L
7	9606.ENSP00000425996	0.623	Short transmembrane mitochondrial protein 1
8	9606.ENSP00000293362	0.605	Proteasome activator complex subunit 3
9	9606.ENSP00000360530	0.605	NMDA receptor synaptonuclear signaling and neuronal migration factor
10	9606.ENSP00000216442	0.557	V-type proton ATPase subunit D
11	9606.ENSP00000358363	0.538	Myomegalin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.652	biological regulation
GO:0050789	0.601	regulation of biological process
GO:0050794	0.593	regulation of cellular process
GO:0071840	0.381	cellular component organization or biogenesis
GO:0016043	0.349	cellular component organization
GO:0006996	0.329	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0070013	0.957	intracellular organelle lumen
GO:0043232	0.944	intracellular non-membrane-bounded organelle
GO:0005829	0.926	cytosol
GO:0005634	0.926	nucleus
GO:0031981	0.900	nuclear lumen
GO:0005654	0.883	nucleoplasm
GO:0032991	0.647	protein-containing complex
GO:0120025	0.610	plasma membrane bounded cell projection
GO:0005929	0.600	cilium
GO:0016020	0.336	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]