StarFunc result for job id A6NNY8

User Input

>input (438 residues)
MCKDYVYDKDIEQIAKEEQGEALKLQASTSTEVSHQQCSVPGLGEKFPTWETTKPELELL
GHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPEL
CLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHC
KGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSF
WPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMN
KLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNN
ENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK
QVLEHESEKVKEMNTQAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NNY8	1.000	1.000	1.328E-89	438	1.000	1.000	A6NNY8.pdb.gz	UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens OX=9606 GN=USP27X PE=1 SV=3
2	AFDB:Q5DU02	0.831	0.695	2.340E-71	525	0.804	0.670	Q5DU02.pdb.gz	UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus OX=10090 GN=Usp22 PE=2 SV=2
3	AFDB:Q70EK9	0.793	0.492	4.068E-65	711	0.715	0.440	Q70EK9.pdb.gz	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
4	AFDB:Q9VVR1	0.724	0.641	3.266E-52	496	0.500	0.442	Q9VVR1.pdb.gz	NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster OX=7227 GN=not PE=1 SV=4
5	AFDB:Q9LEW0	0.703	0.559	1.005E-44	557	0.354	0.278	Q9LEW0.pdb.gz	UBP22_ARATH Ubiquitin C-terminal hydrolase 22 OS=Arabidopsis thaliana OX=3702 GN=UBP22 PE=1 SV=1
6	AFDB:O57429	0.662	0.804	5.149E-35	357	0.263	0.322	O57429.pdb.gz	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
7	AFDB:Q4JL29	0.647	0.550	7.269E-35	520	0.295	0.248	Q4JL29.pdb.gz	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
8	AFDB:E9QFQ5	0.624	0.673	1.363E-33	404	0.269	0.292	E9QFQ5.pdb.gz	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
9	AFDB:Q09738	0.621	0.606	2.158E-33	449	0.272	0.265	Q09738.pdb.gz	UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp8 PE=3 SV=1
10	AFDB:O74442	0.649	0.623	2.286E-33	457	0.242	0.232	O74442.pdb.gz	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
11	PDB:3mhsA	0.641	0.619	8.263E-32	455	0.272	0.262	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:4fjcE	0.559	0.564	7.661E-27	434	0.253	0.256	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:5cvnB	0.607	0.815	5.727E-26	321	0.217	0.296	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
14	PDB:4wa6D	0.562	0.592	1.611E-25	415	0.237	0.251	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
15	PDB:5k16B	0.578	0.755	9.036E-25	328	0.217	0.290	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
16	PDB:7w3ax	0.595	0.532	1.901E-23	494	0.217	0.192	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
17	PDB:7yxxA	0.595	0.157	2.683E-23	1754	0.187	0.047	7yxxA.pdb.gz
18	PDB:8a9kD	0.520	0.782	8.971E-23	285	0.196	0.302	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
19	PDB:5gjqx	0.586	0.712	2.124E-22	355	0.187	0.231	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:7ay1D	0.593	0.750	5.978E-22	341	0.219	0.282	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNY8	0.0	921	438	1.000	1.000	UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens OX=9606 GN=USP27X PE=1 SV=3
2	Q5DU02	0.0	731	525	0.806	0.672	UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus OX=10090 GN=Usp22 PE=2 SV=2
3	Q70EK9	0.0	638	711	0.719	0.443	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
4	Q8CEG8	0.0	891	438	0.963	0.963	UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus OX=10090 GN=Usp27x PE=1 SV=2
5	Q9UPT9	0.0	733	525	0.804	0.670	UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens OX=9606 GN=USP22 PE=1 SV=2
6	Q9VVR1	3.28e-149	435	496	0.534	0.472	NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster OX=7227 GN=not PE=1 SV=4
7	Q9LEW0	2.76e-80	260	557	0.377	0.296	UBP22_ARATH Ubiquitin C-terminal hydrolase 22 OS=Arabidopsis thaliana OX=3702 GN=UBP22 PE=1 SV=1
8	Q09738	1.02e-55	192	449	0.313	0.305	UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp8 PE=3 SV=1
9	P50102	1.56e-53	187	471	0.279	0.259	UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP8 PE=1 SV=1
10	O57429	5.21e-48	170	357	0.269	0.331	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
11	O74442	3.74e-46	167	457	0.240	0.230	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
12	H0YLB7	5.49e-46	166	431	0.301	0.306	H0YLB7_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
13	Q6JHV3	3.59e-45	166	498	0.297	0.261	Q6JHV3_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
14	H0YMI4	3.79e-45	166	503	0.301	0.262	H0YMI4_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
15	Q9Y6I4	7.01e-45	165	520	0.301	0.254	UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=2
16	A0A8I6A351	1.56e-44	164	506	0.290	0.251	A0A8I6A351_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
17	D4A4F6	2.88e-44	162	476	0.295	0.271	D4A4F6_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=4
18	Q4JL29	4.33e-44	163	520	0.295	0.248	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
19	H1UUC2	2.23e-43	157	367	0.256	0.305	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
20	O75604	2.38e-43	162	605	0.295	0.213	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11727 ISG65-75	50	14.6	Invariant surface glycoprotein
2	PF15499 Peptidase_C98	2.2	19.4	Ubiquitin-specific peptidase-like, SUMO isopeptidase
3	PF00443 UCH	1.9e-55	199.9	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	3.7e-16	71.2	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000022478

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000006662	0.979	Ataxin-7-like protein 3
2	61853.ENSNLEP00000004368	0.976	SPT3 homolog, SAGA and STAGA complex component
3	61853.ENSNLEP00000023328	0.973	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
4	61853.ENSNLEP00000001656	0.972	TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
5	61853.ENSNLEP00000014037	0.972	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
6	61853.ENSNLEP00000013815	0.962	K(lysine) acetyltransferase 2A
7	61853.ENSNLEP00000005203	0.956	Transcription and mRNA export factor ENY2
8	61853.ENSNLEP00000003285	0.952	Transcriptional adaptor 2A
9	61853.ENSNLEP00000017568	0.951	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
10	61853.ENSNLEP00000018507	0.951	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
11	61853.ENSNLEP00000005066	0.946	Transcriptional adaptor 3
12	61853.ENSNLEP00000004188	0.942	Belongs to the acetyltransferase family. GCN5 subfamily.
13	61853.ENSNLEP00000002436	0.914	SPT20 homolog, SAGA complex component
14	61853.ENSNLEP00000009850	0.914	Uncharacterized protein
15	61853.ENSNLEP00000014362	0.914	Transcriptional adaptor 2B
16	61853.ENSNLEP00000021190	0.898	Transcription initiation factor TFIID subunit 10
17	61853.ENSNLEP00000014344	0.897	Ataxin 7
18	61853.ENSNLEP00000004857	0.881	SPT7 like, STAGA complex gamma subunit
19	61853.ENSNLEP00000023378	0.881	Uncharacterized protein
20	61853.ENSNLEP00000024007	0.881	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.997	protein binding
GO:0004197	0.934	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.996	protein metabolic process
GO:0050789	0.987	regulation of biological process
GO:0070646	0.986	protein modification by small protein removal
GO:0016579	0.971	protein deubiquitination
GO:0050794	0.967	regulation of cellular process
GO:0031647	0.858	regulation of protein stability
GO:0048518	0.831	positive regulation of biological process
GO:0048522	0.620	positive regulation of cellular process
GO:0009987	0.603	cellular process
GO:0019222	0.382	regulation of metabolic process
GO:0060255	0.333	regulation of macromolecule metabolic process
GO:0080090	0.324	regulation of primary metabolic process
GO:0051171	0.324	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0070461	0.978	SAGA-type complex
GO:0005737	0.778	cytoplasm
GO:1905368	0.653	peptidase complex
GO:0000124	0.443	SAGA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.934	Cysteine endopeptidases.

[back to server]