StarFunc result for job id A6NP61

User Input

>input (321 residues)
MERFVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCI
DPYKRAQLKAILSQMNPSLSPRLCKPNTKEVGVQVSPRVDKAVQCSLGPRTLSSCSPWDG
RDPQEPLPACGVTSPATGRRGLIRLRRDGDEAESKALPGPAEASQPQPPSRRSGADRQEE
PGQLEESGEKDAPCPQETKSKQVPGDAASEPLRRPNFQFLEPKYGYFHCKDCKTRWESAY
VWCISGTNKVYFKQLCCKCQKSFNPYRVEAIQCQTCSKSHCSCPQKKRHIDLRRPHRQEL
CGRCKDKRFSCGNIYSFKYVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SXI5	0.122	0.074	5.943E-1	585	0.178	0.097	Q5SXI5.pdb.gz	ZN496_MOUSE Zinc finger protein 496 OS=Mus musculus OX=10090 GN=Znf496 PE=1 SV=1
2	PDB:6wgg2	0.105	0.063	9.101E-1	581	0.040	0.022	6wgg2.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
3	PDB:7pfo4	0.096	0.053	9.668E-1	619	0.025	0.013	7pfo4.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
4	AFDB:O42967	0.107	0.065	1.305	603	0.156	0.083	O42967.pdb.gz	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1
5	AFDB:O61361	0.087	0.040	1.305	891	0.146	0.053	O61361.pdb.gz	O61361_DROME CROL BETA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
6	AFDB:A0A024R9T6	0.079	0.048	1.662	581	0.156	0.086	A0A024R9T6.pdb.gz	A0A024R9T6_HUMAN HCG17415, isoform CRA_a OS=Homo sapiens OX=9606 GN=SLAIN2 PE=2 SV=1
7	PDB:1b71A	0.082	0.123	1.770	191	0.034	0.058	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
8	AFDB:Q93YV5	0.082	0.072	2.116	401	0.097	0.077	Q93YV5.pdb.gz	DA2_ARATH E3 ubiquitin-protein ligase DA2 OS=Arabidopsis thaliana OX=3702 GN=DA2 PE=1 SV=1
9	PDB:5yzgY	0.104	0.147	2.255	204	0.034	0.054	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:6wgi4	0.097	0.053	2.255	650	0.028	0.014	6wgi4.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
11	AFDB:Q9VQ58	0.069	0.029	2.388	1023	0.171	0.054	Q9VQ58.pdb.gz	Q9VQ58_DROME FI15207p1 OS=Drosophila melanogaster OX=7227 GN=EMSY PE=1 SV=1
12	AFDB:Q54Q48	0.087	0.050	2.695	633	0.072	0.036	Q54Q48.pdb.gz	Y5844_DICDI Putative uncharacterized protein DDB_G0284097 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284097 PE=1 SV=1
13	PDB:7mscq	0.064	0.157	2.872	95	0.012	0.042	7mscq.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
14	AFDB:O07239	0.104	0.060	3.042	620	0.093	0.048	O07239.pdb.gz	O07239_MYCTU Conserved hypothetical proline and threonine rich protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0312 PE=1 SV=1
15	PDB:6wgg7	0.089	0.051	3.051	641	0.022	0.011	6wgg7.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
16	AFDB:B9EKI3	0.076	0.034	3.433	1091	0.174	0.051	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
17	AFDB:Q68FX6	0.065	0.055	3.647	390	0.112	0.092	Q68FX6.pdb.gz	CABS1_RAT Calcium-binding and spermatid-specific protein 1 OS=Rattus norvegicus OX=10116 GN=Cabs1 PE=1 SV=1
18	PDB:3gn5A	0.071	0.161	3.885	132	0.012	0.030	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
19	PDB:5mrcQ	0.081	0.089	3.885	284	0.034	0.039	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
20	PDB:7rroX	0.072	0.042	4.385	636	0.031	0.016	7rroX.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C3VD30	1.58e-103	306	291	0.567	0.625	ZAR1L_MOUSE Protein ZAR1-like OS=Mus musculus OX=10090 GN=Zar1l PE=1 SV=1
2	K7SGN7	7.24e-97	290	307	0.539	0.564	ZAR2B_XENLA Zygote arrest protein 2.L OS=Xenopus laevis OX=8355 GN=zar2.L PE=1 SV=2
3	C0SPG1	5.05e-95	285	302	0.542	0.576	ZAR2A_XENLA Zygote arrest protein 2.S OS=Xenopus laevis OX=8355 GN=zar2.S PE=1 SV=1
4	Q7T3U0	1.62e-82	253	295	0.445	0.485	ZAR1S_XENLA Zygote arrest protein 1.S OS=Xenopus laevis OX=8355 GN=zar1.S PE=1 SV=1
5	Q7T3T8	1.43e-76	239	329	0.402	0.392	ZAR1_DANRE Zygote arrest protein 1 OS=Danio rerio OX=7955 GN=zar1 PE=1 SV=1
6	A0A1L8HBI7	5.86e-72	226	281	0.414	0.473	ZA1LS_XENLA Protein ZAR1-like 1.S OS=Xenopus laevis OX=8355 GN=zar1l.S PE=1 SV=1
7	Q80SU3	2.47e-66	214	361	0.439	0.391	ZAR1_MOUSE Zygote arrest protein 1 OS=Mus musculus OX=10090 GN=Zar1 PE=1 SV=1
8	Q86SH2	3.43e-52	179	424	0.287	0.217	ZAR1_HUMAN Zygote arrest protein 1 OS=Homo sapiens OX=9606 GN=ZAR1 PE=1 SV=1
9	Q38DX3	0.002	39.7	114	0.047	0.132	Q38DX3_TRYB2 3CxxC-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1810 PE=4 SV=1
10	Q9ESJ4	0.29	35.4	714	0.081	0.036	SPN90_MOUSE NCK-interacting protein with SH3 domain OS=Mus musculus OX=10090 GN=Nckipsd PE=1 SV=2
11	D3ZWX4	0.55	34.7	705	0.081	0.037	D3ZWX4_RAT NCK interacting protein with SH3 domain OS=Rattus norvegicus OX=10116 GN=Nckipsd PE=1 SV=3
12	P63072	0.77	33.1	162	0.093	0.185	UBD_MOUSE Ubiquitin D OS=Mus musculus OX=10090 GN=Ubd PE=1 SV=1
13	Q9UFB7	0.83	33.9	747	0.100	0.043	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
14	Q400N4	2.0	32.7	1025	0.069	0.021	Q400N4_CAEEL RING-CH-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=marc-6 PE=1 SV=2
15	Q6FJF0	4.2	31.6	645	0.072	0.036	Q6FJF0_CANGA Candida glabrata strain CBS138 chromosome M complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CRZ1 PE=4 SV=1
16	Q8N2G6	4.3	31.2	241	0.069	0.091	ZCH24_HUMAN Zinc finger CCHC domain-containing protein 24 OS=Homo sapiens OX=9606 GN=ZCCHC24 PE=1 SV=1
17	Q8T6B4	4.9	31.6	1142	0.072	0.020	ABCF4_DICDI ABC transporter F family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcF4 PE=3 SV=1
18	K9IMD0	5.0	31.6	708	0.040	0.018	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1
19	Q96DX8	5.3	30.8	246	0.075	0.098	RTP4_HUMAN Receptor-transporting protein 4 OS=Homo sapiens OX=9606 GN=RTP4 PE=1 SV=3
20	Q9Y2D9	5.7	31.2	606	0.100	0.053	ZN652_HUMAN Zinc finger protein 652 OS=Homo sapiens OX=9606 GN=ZNF652 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13695 zf-3CxxC	3.2e-05	35.7	Zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348300	0.903	Protein BTG4
2	9606.ENSP00000381032	0.642	Nucleoplasmin-2
3	9606.ENSP00000273861	0.633	Sodium/bile acid cotransporter 4
4	9606.ENSP00000364650	0.605	Lysozyme-like protein 1
5	9606.ENSP00000483125	0.569	Protein-arginine deiminase type-6
6	9606.ENSP00000446271	0.532	Protein LSM14 homolog A
7	9606.ENSP00000477715	0.524	Cytoplasmic polyadenylation element-binding protein 1
8	9606.ENSP00000255136	0.512	Polyadenylate-binding protein 1-like
9	9606.ENSP00000446485	0.511	Gametocyte-specific factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0017148	0.994	negative regulation of translation
GO:0022412	0.978	cellular process involved in reproduction in multicellular organism
GO:0001556	0.966	oocyte maturation
GO:0048518	0.395	positive regulation of biological process
GO:0019219	0.365	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.352	regulation of RNA metabolic process
GO:0071840	0.313	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0043227	0.374	membrane-bounded organelle
GO:0032991	0.363	protein-containing complex
GO:0043231	0.347	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]