StarFunc result for job id A6QL63

User Input

>input (1104 residues)
MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMH
SRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELEALLLRSRDPRAGPAV
PGGLPKDALAKLSTLVSRALVRIAKEAQRLSLRFAKCTKYEIQSAMEIVLSWGLAAHCTA
AALAALSLYNMSSAGGDRLGRGKSARCGLTFSVGRVYRWMVDSRVALRIHEHAAIYLTAC
MESLFRDIYSRVVASGVPRSCSGPGSGSGSGPGPSSGPGAAPAADKEREAPGGGAASGGA
CSAASSASGGSSCCAPPAAAAAAVPPAAAANHHHHHHHALHEAPKFTVETLEHTVNNDSE
IWGLLQPYQHLICGKNASGVLCLPDSLNLHRDPQRSNKPGELPMFSQSELRTIEQSLLAT
RVGSIAELSDLVSRAMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQME
WENPNVEPSKVNLQVERPFLVLPPLMEWIRVAVAHAGHRRSFSMDSDDVRQAARLLLPGV
DCEPRQLRADDCFCASRKLDAVAIEAKFKQDLGFRMLNCGRTDLVKQAVSLLGPDGINTM
SEQGMTPLMYACVRGDEAMVQMLLDAGADLNVEVVSTPHKYPSVHPETRHWTALTFAVLH
GHIPVVQLLLDAGAKVEGSVEHGEENYSETPLQLAAAVGNFELVSLLLERGADPLIGTMY
RNGISTTPQGDMNSFSQAAAHGHRNVFRKLLAQPEKEKSDILSLEEILAEGTDLAETAPP
PLCASRNSKAKLRALREAMYHSAEHGYVDVTIDIRSIGVPWTLHTWLESLRIAFQQHRRP
LIQCLLKEFKTIQEEEYTEELVTQGLPLMFEILKASKNEVISQQLCVIFTHCYGPYPIPK
LTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALLSSKPTNDG
TCIEIGYVKYSIFQLVMQYLYYGGPESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAK
SINTDNCVDIYNHAKFLGVTELSAYCEGYFLKNMMVLIENEAFKQLLYDKNGEGTGQDVL
QDLQRTLAIRIQSIHLSSSKGSVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6GQW0	0.892	0.888	0.000	1109	0.976	0.972	Q6GQW0.pdb.gz	ABTB3_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Abtb3 PE=2 SV=2
2	AFDB:Q7TQI7	0.784	0.844	2.130E-82	1024	0.529	0.570	Q7TQI7.pdb.gz	ABTB2_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Abtb2 PE=1 SV=1
3	AFDB:Q54F46	0.173	0.228	5.728E-8	803	0.111	0.152	Q54F46.pdb.gz	WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum OX=44689 GN=warA PE=2 SV=1
4	PDB:8cs9A	0.143	0.190	1.559E-6	796	0.091	0.127	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
5	AFDB:F1QLH3	0.136	0.243	9.978E-6	602	0.033	0.060	F1QLH3.pdb.gz
6	PDB:4oauC	0.179	0.276	1.018E-5	692	0.082	0.132	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
7	AFDB:K8F7T2	0.140	0.359	1.534E-5	399	0.036	0.100	K8F7T2.pdb.gz	K8F7T2_CAEEL Protein roadkill OS=Caenorhabditis elegans OX=6239 GN=mel-26 PE=1 SV=1
8	AFDB:Q8C726	0.139	0.242	1.865E-5	612	0.038	0.069	Q8C726.pdb.gz	BTBD9_MOUSE BTB/POZ domain-containing protein 9 OS=Mus musculus OX=10090 GN=Btbd9 PE=1 SV=1
9	AFDB:Q14678	0.133	0.110	2.097E-5	1352	0.116	0.095	Q14678.pdb.gz	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
10	PDB:5vkqA	0.156	0.119	2.704E-5	1499	0.075	0.055	5vkqA.pdb.gz
11	PDB:2dvwA	0.129	0.579	2.812E-5	229	0.041	0.197	2dvwA.pdb.gz
12	AFDB:Q9W279	0.132	0.325	3.352E-5	417	0.034	0.091	Q9W279.pdb.gz	Q9W279_DROME FI01029p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11275 PE=1 SV=1
13	AFDB:Q9H2C0	0.131	0.236	3.769E-5	597	0.035	0.065	Q9H2C0.pdb.gz	GAN_HUMAN Gigaxonin OS=Homo sapiens OX=9606 GN=GAN PE=1 SV=1
14	AFDB:Q9W2S3	0.137	0.205	4.956E-5	722	0.041	0.062	Q9W2S3.pdb.gz	BTBD9_DROME BTB/POZ domain-containing protein 9 OS=Drosophila melanogaster OX=7227 GN=BTBD9 PE=1 SV=1
15	PDB:6v9hC	0.154	0.546	7.473E-5	270	0.053	0.215	6v9hC.pdb.gz
16	PDB:6dmwA	0.155	0.250	1.195E-4	631	0.082	0.144	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
17	PDB:6pqpA	0.181	0.292	2.065E-4	615	0.069	0.124	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
18	PDB:6a7uA	0.121	0.737	2.715E-4	170	0.034	0.224	6a7uA.pdb.gz
19	PDB:6mwqA	0.128	0.277	6.672E-4	493	0.043	0.097	6mwqA.pdb.gz
20	PDB:6e2fC	0.136	0.210	9.121E-4	647	0.089	0.151	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6GQW0	0.0	2221	1109	0.976	0.972	ABTB3_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Abtb3 PE=2 SV=2
2	Q7TQI7	0.0	936	1024	0.408	0.439	ABTB2_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Abtb2 PE=1 SV=1
3	B9DHT4	9.80e-19	94.4	710	0.047	0.073	ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
4	B7U179	6.03e-17	88.6	737	0.045	0.068	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
5	Q99NH0	2.64e-11	70.9	2603	0.047	0.020	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
6	H0YM23	2.65e-11	70.9	2487	0.047	0.021	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
7	O75179	2.71e-11	70.9	2603	0.047	0.020	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
8	A0A0G2K916	4.24e-11	70.1	2615	0.054	0.023	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
9	Q8IWZ3	5.53e-11	69.7	2542	0.054	0.024	ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
10	E9QEX9	8.12e-11	69.3	2607	0.054	0.023	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
11	A0A0R4IUB2	8.25e-11	69.3	2580	0.054	0.023	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
12	O95199	1.06e-10	68.2	551	0.034	0.069	RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RCBTB2 PE=1 SV=1
13	Q9VCA8	1.58e-10	68.6	4001	0.055	0.015	ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster OX=7227 GN=mask PE=1 SV=2
14	G3X9X1	2.42e-10	67.0	623	0.038	0.067	KBTB2_MOUSE Kelch repeat and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Kbtbd2 PE=1 SV=1
15	Q6ZPP6	2.46e-10	67.0	627	0.038	0.067	Q6ZPP6_MOUSE MKIAA1489 protein (Fragment) OS=Mus musculus OX=10090 GN=Kbtbd2 PE=2 SV=1
16	Q8BSY6	3.18e-10	66.2	508	0.038	0.083	Q8BSY6_MOUSE BTB domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Kbtbd2 PE=2 SV=1
17	Q99LJ7	7.99e-10	65.1	551	0.034	0.067	RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rcbtb2 PE=1 SV=1
18	Q803N0	2.38e-09	63.2	420	0.040	0.105	Q803N0_DANRE Ankyrin repeat and MYND domain-containing protein 2 OS=Danio rerio OX=7955 GN=zgc:55491 PE=1 SV=1
19	Q9VMR4	2.82e-09	63.9	1761	0.051	0.032	Q9VMR4_DROME No mechanoreceptor potential C, isoform H OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=4
20	E0A9E1	2.84e-09	63.9	1732	0.051	0.032	E0A9E1_DROME No mechanoreceptor potential C isoform L OS=Drosophila melanogaster OX=7227 GN=nompC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1e-11	55.9	Ankyrin repeat
2	PF12796 Ank_2	7.7e-15	66.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.3e-14	61.6	Ankyrin repeat
4	PF13637 Ank_4	1.8e-10	52.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3e-10	51.4	Ankyrin repeats (many copies)
6	PF07707 BACK	10	17.6	BTB And C-terminal Kelch
7	PF00651 BTB	5.8e-19	79.7	BTB/POZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280758

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373610	0.723	Otoancorin
2	9606.ENSP00000314724	0.713	Liprin-beta-1
3	9606.ENSP00000297405	0.694	CUB and sushi domain-containing protein 3
4	9606.ENSP00000373539	0.642	Stabilin-2
5	9606.ENSP00000261402	0.621	NUAK family SNF1-like kinase 1
6	9606.ENSP00000290765	0.601	Glutathione S-transferase theta-2B
7	9606.ENSP00000260952	0.598	Asparagine synthetase domain containing 1
8	9606.ENSP00000303769	0.583	AT-hook-containing transcription factor
9	9606.ENSP00000355026	0.569	Rho guanine nucleotide exchange factor 15
10	9606.ENSP00000361057	0.569	Surfeit locus protein 4
11	9606.ENSP00000358529	0.561	Tetraspanin-2
12	9606.ENSP00000011898	0.556	Tetraspanin-9
13	9606.ENSP00000414851	0.552	Elongator complex protein 2
14	9606.ENSP00000179259	0.538	Fructose-2,6-bisphosphatase TIGAR
15	9606.ENSP00000325941	0.538	Synembryn-A
16	9606.ENSP00000376583	0.538	Synembryn-B
17	9606.ENSP00000008527	0.536	Cryptochrome-1
18	9606.ENSP00000312946	0.536	Stabilin-1
19	9606.ENSP00000259365	0.530	Tropomodulin-1
20	9606.ENSP00000341198	0.515	Neogenin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0050896	0.899	response to stimulus
GO:0007154	0.899	cell communication
GO:0023052	0.891	signaling
GO:0007165	0.878	signal transduction
GO:0007178	0.698	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0035556	0.657	intracellular signal transduction
GO:0060395	0.624	SMAD protein signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005737	0.998	cytoplasm
GO:0016020	0.993	membrane
GO:0005634	0.964	nucleus
GO:0031974	0.938	membrane-enclosed lumen
GO:0031981	0.933	nuclear lumen
GO:0005829	0.896	cytosol
GO:0005654	0.896	nucleoplasm
GO:0071944	0.805	cell periphery
GO:0005886	0.595	plasma membrane
GO:0043228	0.380	non-membrane-bounded organelle
GO:0043232	0.351	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]