StarFunc result for job id A6QL64

User Input

>input (1915 residues)
MEDGKRERWPTLMERLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLKYLLLTYYDANK
RDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQN
GANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKCEYQPLLFAVSRRKVKMV
EFLLKKKANVNAIDYLGRSALIHAVTLGEKDIVILLLQHNIDVLSRDAFRKIAGDYAIEA
KNRVIFDLIYEYERKRYEDLPINSNPVSSQKQPALKATSGKEDSISNIATEIKDGQKSGT
VSSQKQPALKDTSDKDDSVSNTATEIKDEQKSGTVLPAVEQCLNRSLYRPDAVAQPVTEN
EFSLESEIISKLYIPKRKIISPRSIKDVLPPVEEAVDRCLYLLDRFAQPVTKDKFALESE
NISEPYFTNRRTISQQSAENLDAACGIDKTENGNMFEDQNVDKEGKALPATGQKANVSPE
QPPLFTHTVKDRDHISTRFLGGMDSLTSSEESSERPPLSTLTLKEADPSSKAAMRRKDSP
PPGKVSSQKQPAEKATSDDKDSVSNIATEIKEGPISGTVSSQKQPAEKATSDEKDSVSNI
ATEIKKGQQSGTVSPQKQSAWKVIFKKKVSLLNIATRIMGGGKSGTVSSQKQPASKATSD
KTDSALNIATEIKDGLQCGTVSSQKQPALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQ
PALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQPALKATTDEKDSVSNIATEIKDGEKS
GTVSSQKPPALTATSDEEGSVLSIARENKDGEKSRTVSSRKKPALKATSDEKDSFSNITR
GKKDGEISRKVSSQKPPTLKGTSDEEDSVLGIARENKDGEKSRTVSSEKPPGLKASSAEK
DSVLNIARGKKDGEKTKRVSSRKKPSLEATSDEKDSFSNITREKKDGEISRKVSSQKPPA
LKGTSDEEDSVLGIARENKDGEKSRTVSSEKPPGLKATSDEKDSVLNIARGKKDGEKTRT
VSSQKPPTLKATSDEEDSVLSIARENKDGEKSRTVSSEKPSGLKATSAEKDSVLNIARGK
KYGEKTKRVSSRKKPALKATSDEKDSVLYIAREKKDGEKSRTVSSPKQPALKAICDKEDS
VPNMATEKKDEQISGTVSCQKQPALKATSDKKDSVSNIPTEIKDGQQSGTVSSQKQPAWK
ATSVKKDSVSNIATEIKDGQIRGTVSPQKQSAQKVIFKKKVSLLNIATRITGGWKSGTEY
PENLPTLKATIENKNSVLNTATKMKDVQTSTPAEQDLEMASEGEQKRLEEYENNQPQVKN
QIHSRDDLDDIIQSSQTVSEDGDSLCCNCKNVILLIDQHEMKCKDCVHLLKIKNTFCLWK
RLIKLKDNHCEQLRVKIRKLKNKASVLQKRISEKEEIKSQLKHEILELEKELCSLRFAIQ
QEKKKRRNVEEVHQKVREKLRITEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSE
TDEKEDLLHENRLMQDEIARLRLEKDTIKNQNLEKKYLKDFEIVKRKHEDLQKALKRNGE
TLAKTIACYSGQLAALTDENTTLRSKLEKQRESRQRLETEMQSYHCRLNAARCDHDQSHS
SKRDQELAFQGTVDKCRHLQENLNSHVLILSLQLSKAESKSRVLKTELHYTGEALKEKAL
VFEHVQSELKQKQSQMKDIEKMYKSGYNTMEKCIEKQERFCQLKKQNMLLQQQLDDARNK
ADNQEKAILNIQARCDARVQNLQAECRKHRLLLEEDNKMLVNELNHSKEKECQYEKEKAE
REVAVRQLQQKRDDVLNKGSATKALLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQ
LTATIRCTKEMEGDTQKLEVEHVMMRKIIKKQDDQIERLEKILQHSSLMLQVFES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2N9	0.155	0.212	0.000	1353	0.662	0.936	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
2	PDB:8cs9A	0.112	0.259	9.100E-15	796	0.035	0.084	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
3	AFDB:M9PCQ3	0.076	0.114	1.226E-14	1111	0.097	0.167	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
4	AFDB:Q8WXD9	0.115	0.151	2.085E-14	1431	0.115	0.154	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
5	AFDB:M9NDA1	0.075	0.101	3.187E-14	1230	0.112	0.174	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
6	AFDB:E9QEX9	0.094	0.071	5.138E-14	2607	0.112	0.082	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
7	AFDB:M9NEB2	0.072	0.102	6.699E-14	1273	0.119	0.179	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
8	PDB:2dvwA	0.116	0.882	1.102E-13	229	0.029	0.240	2dvwA.pdb.gz
9	AFDB:F1R0Q7	0.117	0.137	1.936E-13	1631	0.105	0.124	F1R0Q7.pdb.gz
10	AFDB:A1Z9K8	0.118	0.121	4.069E-13	1871	0.111	0.114	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
11	AFDB:F1QJ05	0.112	0.142	4.069E-13	1509	0.111	0.141	F1QJ05.pdb.gz
12	AFDB:Q9JLU4	0.117	0.128	5.305E-13	1740	0.114	0.126	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
13	PDB:4oauC	0.111	0.290	2.521E-12	692	0.034	0.094	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:6v9hC	0.102	0.658	4.196E-11	270	0.026	0.181	6v9hC.pdb.gz
15	PDB:1wg0A	0.098	0.690	2.687E-10	243	0.027	0.214	1wg0A.pdb.gz
16	PDB:5vkqA	0.104	0.131	5.356E-10	1499	0.031	0.040	5vkqA.pdb.gz
17	PDB:6aunA	0.106	0.313	5.244E-9	618	0.027	0.084	6aunA.pdb.gz
18	PDB:1bu9A	0.070	0.582	6.020E-8	168	0.024	0.274	1bu9A.pdb.gz
19	PDB:6mwqA	0.075	0.282	7.849E-8	493	0.026	0.099	6mwqA.pdb.gz
20	PDB:6pqpA	0.090	0.267	8.728E-8	615	0.022	0.068	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A5B0	0.0	596	309	0.145	0.900	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
2	Q8N2N9	0.0	1822	1353	0.490	0.694	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
3	Q9UPS8	1.43e-155	525	1710	0.162	0.182	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
4	Q811D2	1.30e-109	388	1581	0.130	0.157	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
5	A0JP26	3.63e-61	223	581	0.061	0.201	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
6	Q5TYW2	1.02e-59	224	823	0.057	0.134	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
7	Q6S8J3	8.32e-56	215	1075	0.059	0.105	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
8	A5A3E0	9.40e-56	215	1075	0.059	0.105	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
9	P0CG38	2.90e-54	210	1075	0.058	0.103	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
10	P0CG39	2.90e-54	210	1038	0.058	0.107	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
11	Q9D504	2.93e-50	182	279	0.051	0.348	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
12	Q6NSI1	3.08e-47	175	321	0.044	0.265	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
13	A0A140VJE5	1.44e-44	164	254	0.048	0.362	A0A140VJE5_HUMAN Testicular tissue protein Li 19 OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q92527	1.44e-44	164	254	0.048	0.362	ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=2 SV=3
15	C9JIJ7	5.59e-44	163	263	0.048	0.350	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
16	Q96IX9	2.20e-42	153	119	0.041	0.664	A26L1_HUMAN Putative ankyrin repeat domain-containing protein 26-like 1 OS=Homo sapiens OX=9606 GN=ANKRD36BP1 PE=5 SV=1
17	Q8GZ22	4.63e-21	96.7	240	0.030	0.242	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
18	A0A5F9ZHT8	1.12e-20	102	3891	0.033	0.016	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHF7	1.24e-20	102	3862	0.033	0.016	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZI46	1.27e-20	102	3882	0.033	0.016	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	8.5e-16	68.8	Ankyrin repeat
2	PF12796 Ank_2	4.1e-25	99.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.7e-16	68.4	Ankyrin repeat
4	PF13637 Ank_4	3.5e-27	105.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.3e-14	63.4	Ankyrin repeats (many copies)
6	PF14915 CCDC144C	9.2e-99	342.0	CCDC144C protein coiled-coil region
7	PF19890 DUF6363	1.6e+02	13.5	Domain of unknown function (DUF6363)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000391950

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410470	0.689	Fumarylacetoacetate hydrolase domain-containing protein 2B
2	9606.ENSP00000429896	0.651	Protein FAM178B
3	9606.ENSP00000355121	0.561	Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
4	9606.ENSP00000403302	0.557	Ankyrin repeat domain-containing protein 36C
5	9606.ENSP00000393845	0.507	Peptidyl-prolyl cis-trans isomerase A-like 4G
6	9606.ENSP00000382474	0.502	UPF0545 protein C22orf39
7	9606.ENSP00000485487	0.502	Fer-1-like protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.788	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.834	biological regulation
GO:0050789	0.807	regulation of biological process
GO:0050794	0.753	regulation of cellular process
GO:0000003	0.642	reproduction
GO:0032501	0.630	multicellular organismal process
GO:0032502	0.455	developmental process
GO:0022414	0.383	reproductive process
GO:0071704	0.328	organic substance metabolic process
GO:0050896	0.309	response to stimulus
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005622	0.957	intracellular anatomical structure
GO:0016020	0.939	membrane
GO:0043227	0.932	membrane-bounded organelle
GO:0043229	0.932	intracellular organelle
GO:0043231	0.838	intracellular membrane-bounded organelle
GO:0043228	0.598	non-membrane-bounded organelle
GO:0043232	0.530	intracellular non-membrane-bounded organelle
GO:0005737	0.464	cytoplasm
GO:0005886	0.371	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]