StarFunc result for job id A7E2V4

User Input

>input (1837 residues)
MELMFAEWEDGERFSFEDSDRFEEDSLCSFISEAESLCQNWRGWRKQSAGPNSPTGGGGG
GGSGGTRMRDGLVIPLVELSAKQVAFHIPFEVVEKVYPPVPEQLQLRIAFWSFPENEEDI
RLYSCLANGSADEFQRGDQLFRMRAVKDPLQIGFHLSATVVPPQMVPPKGAYNVAVMFDR
CRVTSCSCTCGAGAKWCTHVVALCLFRIHNASAVCLRAPVSESLSRLQRDQLQKFAQYLI
SELPQQILPTAQRLLDELLSSQSTAINTVCGAPDPTAGPSASDQSTWYLDESTLTDNIKK
TLHKFCGPSPVVFSDVNSMYLSSTEPPAAAEWACLLRPLRGREPEGVWNLLSIVREMFKR
RDSNAAPLLEILTDQCLTYEQITGWWYSVRTSASHSSASGHTGRSNGQSEVAAHACASMC
DEMVTLWRLAVLDPALSPQRRRELCTQLRQWQLKVIENVKRGQHKKTLERLFPGFRPAVE
ACYFNWEEAYPLPGVTYSGTDRKLALCWARALPSRPGASRSGGLEESRDRPRPLPTEPAV
RPKEPGTKRKGLGEGVPSSQRGPRRLSAEGGDKALHKMGPGGGKAKALGGAGSGSKGSAG
GGSKRRLSSEDSSLEPDLAEMSLDDSSLALGAEASTFGGFPESPPPCPLHGGSRGPSTFL
PEPPDTYEEDGGVYFSEGPEPPTASVGPPGLLPGDVCTQDDLPSTDESGNGLPKTKEAAP
AVGEEDDDYQAYYLNAQDGAGGEEEKAEGGAGEEHDLFAGLKPLEQESRMEVLFACAEAL
HAHGYSSEASRLTVELAQDLLANPPDLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFL
LTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLGPSEMS
TMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAA
VAALGMKTTVSEAEHPLLCEGTRREKGDLALALMITYKDDQAKLKKILDKLLDRESQTHK
PQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPGPTEGF
TEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTG
MASIDSSAPETTSDSSPTLSRRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRR
ASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGNSSTSI
FTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGS
AALTILVECWDGHLTPPEVASLADRASRARDSNMVRAAAELALSCLPHAHALNPNEIQRA
LVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAREGATS
CSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHG
HSPGLHPYTALQPHLPCSPQYLTHPAHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQ
YPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVACELWGQGTVSSVHPAST
FPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGR
RAHNDHPNNFSRSPPYTDDVKWLLGLAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETL
QRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAFCL
TPMGMMQFNDILQNLKRSKQTKELWQRVSLEMATFSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7E2V4	1.000	1.000	0.000	1837	1.000	1.000	A7E2V4.pdb.gz	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
2	AFDB:E9QEX9	0.062	0.049	7.324E-3	2607	0.126	0.089	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
3	AFDB:Q9Y6J0	0.059	0.053	4.071E-2	2220	0.109	0.091	Q9Y6J0.pdb.gz	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
4	AFDB:Q55DL8	0.033	0.037	4.564E-2	1574	0.093	0.108	Q55DL8.pdb.gz	Q55DL8_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcT PE=4 SV=1
5	AFDB:Q6DRL4	0.044	0.045	8.085E-2	1824	0.118	0.119	Q6DRL4.pdb.gz	TICRR_DANRE Treslin OS=Danio rerio OX=7955 GN=ticrr PE=2 SV=1
6	PDB:7sukSP	0.095	0.082	8.737E-2	2234	0.029	0.024	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
7	AFDB:Q7PLI2	0.072	0.066	1.097E-1	2077	0.081	0.071	Q7PLI2.pdb.gz	NIPB_DROME Nipped-B protein OS=Drosophila melanogaster OX=7227 GN=Nipped-B PE=1 SV=3
8	PDB:6tc0C	0.091	0.143	1.185E-1	994	0.034	0.062	6tc0C.pdb.gz
9	PDB:4bujB	0.068	0.081	1.279E-1	1367	0.028	0.037	4bujB.pdb.gz
10	PDB:7nfeA	0.093	0.059	1.548E-1	3585	0.042	0.021	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
11	AFDB:Q2QCI8	0.065	0.057	2.097E-1	2173	0.063	0.053	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
12	AFDB:P34333	0.035	0.035	2.263E-1	1778	0.092	0.095	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
13	PDB:6bq1B	0.109	0.187	2.354E-1	728	0.062	0.155	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
14	PDB:7wttK	0.077	0.126	2.445E-1	1022	0.019	0.034	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:6ww7B	0.043	0.175	2.639E-1	281	0.015	0.096	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
16	AFDB:O60184	0.042	0.055	2.844E-1	1102	0.079	0.132	O60184.pdb.gz	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
17	PDB:7sicA	0.096	0.068	2.848E-1	2773	0.034	0.022	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
18	PDB:7sqcR1	0.073	0.067	2.848E-1	2080	0.042	0.037	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:7kw7E	0.054	0.186	2.959E-1	327	0.017	0.095	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
20	AFDB:A0A096MKF8	0.074	0.068	3.069E-1	2190	0.134	0.113	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7E2V4	0.0	3758	1837	1.000	1.000	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
2	Q3UHH1	0.0	3617	1832	0.967	0.969	ZSWM8_MOUSE Zinc finger SWIM domain-containing protein 8 OS=Mus musculus OX=10090 GN=Zswim8 PE=1 SV=1
3	Q9VWN9	0.0	637	2103	0.174	0.152	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
4	Q21875	6.56e-77	286	1717	0.094	0.100	Q21875_CAEEL SWIM-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebax-1 PE=1 SV=2
5	Q8C7B8	3.15e-57	220	1101	0.084	0.140	ZSWM4_MOUSE Zinc finger SWIM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zswim4 PE=1 SV=2
6	Q80TB7	5.17e-47	187	1207	0.068	0.103	ZSWM6_MOUSE Zinc finger SWIM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zswim6 PE=1 SV=3
7	Q9P217	5.57e-47	187	1185	0.063	0.098	ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZSWIM5 PE=2 SV=2
8	Q7Z429	0.25	38.1	371	0.013	0.065	LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1
9	Q9Z1T6	0.92	37.0	2097	0.026	0.022	FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus OX=10090 GN=Pikfyve PE=1 SV=3
10	F1M078	1.9	35.8	1198	0.015	0.023	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
11	Q9Y2I7	2.2	35.8	2098	0.024	0.021	FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3
12	Q9JHW1	8.8	33.9	1378	0.020	0.027	CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus OX=10116 GN=Cpd PE=1 SV=2
13	Q9JJ66	9.2	33.5	499	0.013	0.046	CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus OX=10090 GN=Cdc20 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04434 SWIM	41	15.3	SWIM zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262306	0.948	Elongin-B
2	9606.ENSP00000444856	0.913	Cullin-2
3	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
4	9606.ENSP00000304697	0.900	Polyubiquitin-B
5	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000441543	0.900	Polyubiquitin-C
7	9606.ENSP00000216225	0.865	E3 ubiquitin-protein ligase RBX1
8	9606.ENSP00000478121	0.856	Elongin-C
9	9606.ENSP00000380903	0.803	Roundabout homolog 3
10	9606.ENSP00000252744	0.696	Zinc finger SWIM-type containing 6
11	9606.ENSP00000352614	0.694	Zinc finger SWIM-type containing 5
12	9606.ENSP00000254323	0.676	Zinc finger SWIM-type containing 4
13	9606.ENSP00000291900	0.671	Protein zer-1 homolog
14	9606.ENSP00000294353	0.645	Protein zyg-11 homolog B
15	9606.ENSP00000360583	0.633	Protein zyg-11 homolog A
16	9606.ENSP00000244769	0.611	Ataxin-1
17	9606.ENSP00000260983	0.604	E3 ubiquitin-protein ligase HECW2
18	9606.ENSP00000349076	0.592	Atrophin-1
19	9606.ENSP00000417335	0.563	Roundabout homolog 2
20	9606.ENSP00000420321	0.552	Roundabout homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0005515	0.829	protein binding
GO:0003824	0.606	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0051252	0.968	regulation of RNA metabolic process
GO:0048522	0.959	positive regulation of cellular process
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0051173	0.958	positive regulation of nitrogen compound metabolic process
GO:0009894	0.957	regulation of catabolic process
GO:0031325	0.950	positive regulation of cellular metabolic process
GO:0009987	0.931	cellular process
GO:2000628	0.829	regulation of miRNA metabolic process
GO:0008152	0.781	metabolic process
GO:0043170	0.760	macromolecule metabolic process
GO:0044238	0.730	primary metabolic process
GO:0006807	0.722	nitrogen compound metabolic process
GO:0019538	0.710	protein metabolic process
GO:0044237	0.707	cellular metabolic process
GO:0031329	0.682	regulation of cellular catabolic process
GO:2000630	0.609	positive regulation of miRNA metabolic process
GO:0009896	0.400	positive regulation of catabolic process
GO:0031331	0.392	positive regulation of cellular catabolic process
GO:0044260	0.391	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031461	0.998	cullin-RING ubiquitin ligase complex
GO:0110165	0.995	cellular anatomical entity
GO:0005829	0.980	cytosol
GO:0043226	0.688	organelle
GO:0005576	0.643	extracellular region
GO:0031463	0.588	Cul3-RING ubiquitin ligase complex
GO:0043227	0.586	membrane-bounded organelle
GO:0043229	0.580	intracellular organelle
GO:0005615	0.570	extracellular space
GO:0031981	0.525	nuclear lumen
GO:0005654	0.485	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]